KEGG   Rickettsia rickettsii Colombia: RPL_01280Help
Entry
RPL_01280         CDS       T01722                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rrc  Rickettsia rickettsii Colombia
Pathway
rrc00020  Citrate cycle (TCA cycle)
rrc00310  Lysine degradation
rrc01100  Metabolic pathways
rrc01110  Biosynthesis of secondary metabolites
rrc01120  Microbial metabolism in diverse environments
rrc01130  Biosynthesis of antibiotics
rrc01200  Carbon metabolism
Module
rrc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rrc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rrc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPL_01280
  Amino acid metabolism
   00310 Lysine degradation
    RPL_01280
Enzymes [BR:rrc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RPL_01280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: AFB23167
Position
complement(236478..237665)
Genome map
AA seq 395 aa AA seqDB search
MRVNIIVPSLGESITEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVHAPCNGTIGKIS
KTDGANVAVGEEIGEINEGASVNTAGTNNESAKAQPVTQPTSEKPAVANNTLAPSVQKLV
TENKLDPNNIKGTGRDGRITKGDVLATINTTTTSAPAISKSNEERVQRVRMSRLRKTIAQ
RLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHTVKLGFMSFFVKATIEALKLIP
SVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADKMGFAEVEKTIGILAKQAREGK
LSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEIRPMMYI
ALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLLNL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgagagttaacattatagtaccgtcgcttggggagtccataacggaagcaactattgcc
aaatggtataagaaagaaggcgattcggttaaaaccgatgaattactgttagaaatcgaa
accgaaaaagtgactttagaagttcatgctccttgcaatggtactataggtaaaatatcg
aaaactgacggtgcaaatgtagcagttggcgaagaaataggcgaaataaatgaaggagca
tctgtaaatactgccggtactaataatgaatctgctaaagctcaaccagtaacacaacct
acttcagaaaaacctgccgtggctaataatactcttgctccttctgtacaaaaattagtt
accgaaaataagcttgaccccaataatataaaaggaacaggtagagatggtagaattacc
aaaggtgacgtgcttgcaacaataaacactacgactacttctgctcctgcaataagtaaa
tctaatgaagaaagagtgcagcgtgttcgtatgtcacgcttgcgtaaaactattgcacag
cgtttaaaagattcacaaaatacagcagctattttgactacttttaatgaaatcgatatg
tcaaaagtaattgctttgcgtaatcaatataaagaagagtttgagaaaaagcacactgtg
aaacttgggtttatgtctttctttgttaaagcaacaattgaagctttaaagcttattccg
tcggtaaatgctgaaatagatggcgatgatttagtatataaaaattactatgatataggt
gtagctgtcggaacagagcaagggcttgttgtaccggttgttagggatgccgataaaatg
ggatttgccgaagtggagaaaactataggaattttggctaaacaagctcgtgagggtaag
ctttctatggctgatttgtcaggtgggacattctcgatttctaacggaggcgtatatggc
tcattattatctacaccgattattaatcctcctcaatcaggtattctaggcttacataaa
accgaggaaagagctgtagttatagacggtaaaattgaaatacgtccgatgatgtatata
gctttatcttacgatcatcgtataattgatgggaaagaaggagtatcgttcttggtaaaa
attaagcagcttattgagaatcctgaaaagttattgttaaatttgtaa

DBGET integrated database retrieval system