KEGG   Rickettsia rickettsii Colombia: RPL_01930Help
Entry
RPL_01930         CDS       T01722                                 

Definition
ribosomal large subunit pseudouridine synthase C
Orthology
K06179  
23S rRNA pseudouridine955/2504/2580 synthase [EC:5.4.99.24]
Organism
rrc  Rickettsia rickettsii Colombia
Brite
Enzymes [BR:rrc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.24  23S rRNA pseudouridine955/2504/2580 synthase
     RPL_01930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
350040..350951
Genome map
AA seq 303 aa AA seqDB search
MIIDVNTPISSRLDKYLKRLYPLLTQGVIEKALRQKQITVNSQKAEASLSVKGGDKIFIN
DKFNLPVKQPEKLVFTDAEIKLAKKITTDYLIYADDNLIAINKPAGLATQGGTKINLSID
SALKYLNYKGTDFKLVHRLDKKTSGLLLIAKNYLSSVKLHDAFKEKLVVKTYFAVTYGKP
IKNVGEVRSNIEKSKGSTPKITDIDSENGKLAITYYKVLKSLDNNLFLIEFTPVTGRMHQ
LRLHAKLLGCPILGDDKYGNKAIMPYSKYMFLHAHNICLSEKIFGQEIKLEAKLPFYFTR
RLT
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgatgtcaatactcctatttcttctagattagataaatatttaaaacgtcta
tatcccttattgactcaaggagtaatagagaaagcattacgtcaaaaacaaattaccgtt
aattctcagaaagcagaagcgagtttaagcgtaaagggcggcgataaaatttttattaac
gataagtttaatttacctgttaagcaacctgaaaaattagtttttaccgacgctgaaatt
aagctagcgaagaaaattactaccgattatttgatatatgcagatgataatttaatagct
ataaataaacctgcaggtcttgctactcaaggcggcactaaaataaatttatctattgac
tctgcattaaaatatttgaattataaaggtactgattttaagctagtacatagattagat
aaaaaaacaagcggtttgctcttaatagccaaaaattatttaagtagtgtaaaacttcat
gatgcttttaaagaaaaattggttgtaaaaacatattttgccgtaacctatgggaagcca
attaaaaatgtaggcgaagttagaagtaatatagaaaagagtaaaggaagtacacctaaa
attactgatattgatagtgaaaatggtaaacttgccattacttattataaagtacttaaa
tcacttgataataacttatttttaattgaatttacgccggttacaggtagaatgcatcaa
ttaaggttgcatgctaaattattaggttgtccgatacttggagatgataaatatggtaat
aaagcaataatgccgtatagtaaatatatgttcttgcatgctcataatatatgtttatct
gaaaaaatttttggtcaagagattaagttagaagcaaaattaccgttttattttactaga
cgtcttacataa

DBGET integrated database retrieval system