KEGG   Rickettsia rickettsii Colombia: RPL_02985Help
Entry
RPL_02985         CDS       T01722                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
rrc  Rickettsia rickettsii Colombia
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rrc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
525385..525999
Genome map
AA seq 204 aa AA seqDB search
MIGKLSGKVDSQGDDYVIIDVNGVGYLVYASGKTLGTLAEGEFYKLFIETHVREEHIHLY
GFLTLEEKIFFNLLQSVNGIGTRMALFILSSLTPSDIQIAVNNEDKNIFKAISGVGAKLA
ERIVLELKGKVAKISSGSAIIKESLNIKNITPVASNEVIKALVNLGFSRFEAQNAVQGII
TQNPEISIDELIKTALKNRNSNFS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtaaattaagtggtaaagttgattcccaaggcgatgattacgttataattgac
gtaaacggggtagggtacttagtctatgcttcaggtaaaactttaggtacacttgctgaa
ggggagttttataaactatttattgaaacccatgttcgagaggaacatattcatctttac
ggttttttgactctagaagagaagattttttttaatttactacaatcagtaaatggtata
ggtacaagaatggctttatttatcttatcaagccttacaccttcagatattcaaattgct
gtaaataatgaagataaaaatatatttaaagcaatatccggagtaggggctaaacttgct
gaacgtatagtgctagagctgaaaggtaaagtagcgaaaatatcaagcggttcagctatt
attaaagagagcttaaatattaagaatatcacacccgttgcaagtaatgaagtaataaaa
gctctagtaaatctaggattttctagatttgaagctcaaaacgctgttcaaggcatcatt
acccaaaatcccgaaatctctattgatgaattaatcaaaacagccctgaaaaatcgaaat
tctaattttagttga

DBGET integrated database retrieval system