KEGG   Rickettsia rickettsii Colombia: RPL_03355Help
Entry
RPL_03355         CDS       T01722                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rrc  Rickettsia rickettsii Colombia
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rrc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RPL_03355 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RPL_03355 (sucC)
   00640 Propanoate metabolism
    RPL_03355 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RPL_03355 (sucC)
Enzymes [BR:rrc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RPL_03355 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(590185..591345)
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINETIDKLNTEVYVVKAQIHAGGRGKAGGV
KVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCEILKEYYFSIVFDRSASC
ITFIASTEGGVDIEEVAEKTPEKIIKFSVDPATGLQDFHMRGIAYELGFKDNQAKQMKEI
VKSVYNAFIETDAAQIEINPLIVNSDGNLLALDAKITFDDNGLLRHPNITAMRDHDEEDP
LETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGASPANFLDVGGGADRERVKE
ALKIILSDKAVQGILVNIFGGIMRCDIIAEGIIAAAKDIGIKVPLVVRLAGTNVEKGKEI
LSNSGLEIIPAHDLADAANKIVEAIR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagcaaaagagattttaagaaaatacggcgtacctacttcc
accgggctagttgttacgaaaaccgaaaagattaatgaaaccatagataaattaaatacg
gaagtatatgtggttaaagcacaaatacatgccggcggtagaggtaaagcaggcggtgtt
aaggttgttaagagtaaagaagaagccaaaaaagttgctcatgacatgtttggtattaat
ttagtaacgcatcaaacaggacctcaaggacaaaaagtaaaccgtctttatatcgaatca
ggttgtgagattttaaaagaatattattttagtatagtatttgatagatcggctagctgt
attacttttatagcttctacggaaggaggagttgatattgaagaggtagcagaaaaaact
ccggaaaaaattattaaattttccgttgatcctgcaaccggtttacaagattttcatatg
cgaggcatagcttatgagttaggctttaaggataaccaagctaaacagatgaaagaaata
gtaaaatcagtctataatgcttttattgaaaccgatgcagcacaaatcgaaatcaaccca
ttaattgtaaatagcgacgggaacttattagctttagatgcaaaaattacttttgacgat
aacggcttattgcggcatccgaatattacggcaatgcgtgatcatgatgaagaagatcct
ctagaaactagagcagcgaatgcaggacttagctatgtaaaaatggacggtaatatcggt
tgtatggttaacggtgccggtcttgccatggccactatggatattattaaactttacggt
gcttcacctgctaatttcttggatgtcggtggtggagctgatcgtgagcgtgtaaaagaa
gctttaaaaataattttatctgataaagcagtacaagggattctagttaatattttcggc
ggtatcatgcgttgtgatattatagcagaagggattattgccgctgcaaaagacataggt
ataaaagtaccgttagtagttcgtttagccggtacaaacgttgaaaaaggtaaagaaatt
ttatcaaattccggtttagaaataataccggcacatgatttagcagatgcggcaaataaa
atagttgaagcgatacggtag

DBGET integrated database retrieval system