KEGG   Rickettsia rickettsii Colombia: RPL_06570Help
Entry
RPL_06570         CDS       T01722                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
rrc  Rickettsia rickettsii Colombia
Pathway
rrc00230  Purine metabolism
rrc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RPL_06570 (gmk)
Enzymes [BR:rrc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     RPL_06570 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin CPT AAA_33 AAA_18 AAA_16 RsgA_GTPase AAA AAA_22 Fur_reg_FbpB MMR_HSR1 ABC_tran
Motif
Other DBs
NCBI-ProteinID: AFB24098
Position
complement(1093175..1093864)
Genome map
AA seq 229 aa AA seqDB search
MTTKNKRVLQKCAYREEFKGDMERSTAVTSKLPLEVELSRNSKGLIIILSSPSGTGKSSL
AKALLKIDNNLRLSISATTRKPRLGEVEGINYYFKTGLEFEELVKQNKFLEYAKIYDNYY
GTPKEYVEMLLNQGLDVLFDIDWQGARSIKENATNVVAIFVLPPNIEVLEQRLRNRATDN
EEAIKLRMQSAQNEISHANEYDYVVTNDDFDRTLKKIHAIIVAARDKAF
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaaaaataaaagagttcttcagaaatgcgcttatagagaggaatttaaaggc
gacatggaacgtagcaccgcagtgacgtctaaattacctctagaagtagaactttcgagg
aactctaaaggactgattataattttatcttccccttcaggtacaggtaagtcgagttta
gctaaagcattattgaaaatagataataatttgcgtttatctatttcggcaactacaaga
aaaccacgtttaggagaagtagagggcataaactattactttaagaccggtctagagttt
gaagaattagttaagcagaataaattccttgaatatgctaaaatatacgataattattac
ggtacgcctaaagaatatgtcgaaatgttattaaatcaaggcttggatgttttgtttgat
attgattggcaaggagcacggagtattaaggaaaatgctactaatgttgttgctatattt
gtattgcctcctaatattgaagtattggaacaacgcttaagaaatagagcgaccgataat
gaagaagcaataaaattacgtatgcagtcggcacaaaacgaaatatcacatgctaatgag
tatgattatgtagttactaacgatgactttgaccggacgcttaaaaaaatacatgcgatt
atagttgcagcacgagacaaagcgttttga

DBGET integrated database retrieval system