KEGG   Rickettsia rickettsii Colombia: RPL_07525Help
Entry
RPL_07525         CDS       T01722                                 

Definition
(GenBank) D-beta-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rrc  Rickettsia rickettsii Colombia
Pathway
rrc00072  Synthesis and degradation of ketone bodies
rrc00650  Butanoate metabolism
rrc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    RPL_07525
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    RPL_07525
Enzymes [BR:rrc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     RPL_07525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: AFB24274
Position
1262060..1262326
Genome map
AA seq 88 aa AA seqDB search
MAENNITVNAICLGYVNTPLVRNQIADTAKARHISEKSALRDVILKSQATKKFVEADEIA
NLVIFLCDKKASSITGSGLLIDGGWMAQ
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagaataatattacagttaatgctatctgtctcggttacgtcaacacaccatta
gtaaggaatcaaatagcagatactgctaaagctagacatataagtgaaaaatcagcgtta
agggatgtaatccttaaatctcaagctacgaaaaaatttgtagaagctgatgaaatagca
aacttagtaatattcttatgtgataaaaaagcatcatcaataacaggtagtggactcttg
atagatggtggctggatggcacagtag

DBGET integrated database retrieval system