KEGG   Rickettsia rickettsii Colombia: RPL_07525Help
Entry
RPL_07525         CDS       T01722                                 

Definition
D-beta-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rrc  Rickettsia rickettsii Colombia
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rrc00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:rrc00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1262060..1262326
Genome map
AA seq 88 aa AA seqDB search
MAENNITVNAICLGYVNTPLVRNQIADTAKARHISEKSALRDVILKSQATKKFVEADEIA
NLVIFLCDKKASSITGSGLLIDGGWMAQ
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
gtggctgagaataatattacagttaatgctatctgtctcggttacgtcaacacaccatta
gtaaggaatcaaatagcagatactgctaaagctagacatataagtgaaaaatcagcgtta
agggatgtaatccttaaatctcaagctacgaaaaaatttgtagaagctgatgaaatagca
aacttagtaatattcttatgtgataaaaaagcatcatcaataacaggtagtggactcttg
atagatggtggctggatggcacagtag

DBGET integrated database retrieval system