KEGG   Rubrobacter radiotolerans: RradSPS_0068Help
Entry
RradSPS_0068      CDS       T03080                                 

Definition
4-aminobutyrate aminotransferase and related aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
rrd  Rubrobacter radiotolerans
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RradSPS_0068
   00650 Butanoate metabolism
    RradSPS_0068
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RradSPS_0068
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RradSPS_0068
Enzymes [BR:rrd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RradSPS_0068
Amino acid related enzymes [BR:rrd01007]
 Aminotransferase (transaminase)
  Class III
   RradSPS_0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
75163..76485
Genome map
AA seq 440 aa AA seqDB search
MIQKGTTPEELNRRKQAVLPAWISTNYERPIELVDGEGFRVRDSEGNEYLDLFGGIVTTI
SGHNVPEIVEAVQRQAGRIMHSSTLYLIESQVRLAEKLVELSPIRGDQKVFFVGSGSEAN
EAALLFATHYRRSSEIIALRGSYHGGSFGTMGITGQASWRATPRSALDVSYAMNPHPSYS
PLLEGMSPERRAEACAKDLRNLIETSTAGHIAAFIAEPIQGVGGFIEHPEGYLRRVKEVL
DEQGILFISDEVQTAFGRTGSAFWGVENHGVEPDMITMAKGLGNGLAIGAVMGRSEVVDS
ISPKLHISTFGGNHISSAGALANLEFILKNDLQKNADEVGGYLKGRLEALKEKYEAVGEV
RGRGLMLAIELVGPDGSPDPAAAMRFMEACRERGVLVGKGGLRSNAIRISPPLTLTREAA
GEAADVFEDALAALGAEVRR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgatacaaaaaggaacgacgcccgaggagttgaaccgaaggaagcaggcggtgcttccg
gcctggatctccacaaactacgagcgaccgatagagcttgtggacggtgaggggttccgg
gtgcgggactcggaggggaacgagtacctggatctcttcgggggaatcgtgaccacaatc
agcggtcataacgtcccggagatcgtcgaggccgtccagaggcaggccggcaggataatg
cactcctcgacgctgtacctgatcgagtcccaggtgaggctcgcggagaagctcgtcgag
ctgtctcccatacggggcgaccagaaggtattttttgtcgggagcggctctgaggcgaac
gaggccgcgctcctgtttgccacccactaccgccgttcgagcgagatcatcgccctcagg
ggctcctatcacggcggctcgttcgggacgatggggataaccgggcaggcttcctggcgc
gcgacgccacgctccgcgctcgacgtgagctacgccatgaacccgcatccctcctacagc
ccccttctcgaaggtatgtcccccgagagacgagccgaggcttgcgcgaaggacctgagg
aaccttatagagacgagcaccgccgggcacatcgcggcgtttatcgccgagccgatacag
ggcgtcgggggctttatcgagcacccggagggctatctgcggcgggttaaggaggtgctc
gacgagcagggcatcttgttcatctccgacgaggtccagaccgctttcggaaggacggga
agcgcgttctggggagtggagaaccacggcgtcgagccggacatgatcacgatggcgaag
ggcctcgggaacgggctcgcgatcggggcggtgatgggccgctcggaggtcgtggactcc
ataagccccaagctgcacatctcgaccttcggcgggaaccacatctcctccgcgggtgct
ctcgccaacctggagttcatcctcaagaacgacctccagaaaaacgccgacgaggtcgga
gggtatctcaagggcaggctggaggccctgaaggagaagtacgaagccgtgggcgaggtc
cgcggacgcggtctgatgctcgcgatcgagcttgtcggaccggacggctcgccggacccg
gccgctgcgatgcgcttcatggaggcgtgccgggagcgcggggtccttgtcgggaagggc
ggcctgaggagcaacgcgattcgcatctccccgccgctcacgctaacccgggaggccgcc
ggcgaggccgcggacgtctttgaggacgcgctcgccgctctcggagcggaggtccggcgc
tga

DBGET integrated database retrieval system