KEGG   Rubrobacter radiotolerans: RradSPS_0192Help
Entry
RradSPS_0192      CDS       T03080                                 

Definition
trehalose synthase
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rrd  Rubrobacter radiotolerans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RradSPS_0192
Enzymes [BR:rrd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RradSPS_0192
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     RradSPS_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
207092..210514
Genome map
AA seq 1140 aa AA seqDB search
MSEIREDGRIGRAETHPRDPEWYKDAIIYHLHVKAFKDSDNNGIGDFKGLTSRLEYIREL
GVTAIWIMPFYPSPLRDDGYDIAEYKNVHPDYGTRRDVRAFIRRAHELGLRVITELVINH
TSDQHPWFQRARRAPKGSARRDFYVWSDDPHKYEGTRIIFTDTETSNWSWDPVAEQYYWH
RFFSHQPDLNHDNPQVFKAIMNVMRFWLDAGVDGLRLDAIPYLIEREGTDNENLPETHEV
LKRMRAEMDASYEDRLFLAEANQWPEDVLPYFGDFEAGGNECHMAFHFPLMPRIYMAVAQ
EDRHPIVEIMQQTPEIPSSCQWAIFLRNHDELTLEMVTDKERDYMYETYASDPRARINVG
IRRRLAPLLDNDRPKIELLNSLLMSMPGTPIIYYGDELGMGDNIYLGDRDAVRTPMQWTA
DRNAGFSKADPQRLYLPPIMDSVYGYESINVEAQSRNAGSLLNWMKRLINVRKSYKAFGR
GELEFLHPGNRRVLAYLRRYEGADGETEDILCIANLSRSAQPVELDLARFSGRVPVELMG
GTSFPPVGALPYFITLPGYGFYWFELSKEVAAPRWHQESPKVVEMPVVVLPAGRQPSSEI
KRALPLRIPSRQVSLLEKEALANFLEARRWFAGKSAGISRVQVASQAELGGDRLLTVLSV
EVAEGRENGGEPERQLYFLPLSAGWEDEIGEEGIDGLLQHSLAKLRRRSRTGMLYDALAD
EVFCREVVRAMGEGVSIPMGEGRVRFEATGRYEELLGDEDLSELSVRKSSVEQSNTSVII
GERVMLKAYRRLEEGENPEVEVGRFLTEVAGFEHTPPLVGTVEYEGEDGGRTAFAILQGF
VHSQGDGWSYVLDYLERYLDDRTTTTWSLPDGDREDETQEFHEADDAFFDGLMHNLGLRT
GELHAVLAGEVAARTGDPAFVPETASPEEVEGWASAVGEDLKRTFELLKRRRERLPEEAL
PAVEALLERKKEVKALVKEVKSAAKEGLTAVKSRHHGDYHLGQVLVVNNDFQIIDFEGEP
ARSLEERRRKASPLRDVAGMLRSFDYAAKTALSENPEEAKEISYWTEEWLKRTRRSFLSG
YTEGAAGVYGDEESARKLTDLFVVEKALYEIRYELDNRPDWVTIPVRGILDLIGNGEELS
NT seq 3423 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgagatcagagaggacggaaggataggccgggccgagacccacccccgcgacccg
gagtggtacaaggacgcgatcatctaccacctccacgtcaaggcgttcaaggactcggac
aacaacggcatcggggacttcaagggccttacgagccgcctggagtacataagggagctc
ggggtgacggcgatctggatcatgcccttctacccctcccccttgcgcgacgacggctac
gacatcgccgagtacaagaacgtccaccccgactacggcacccgccgcgacgtccgggcg
tttatccgacgagcgcacgagctcggtctgcgcgtcataaccgagctcgtcataaaccac
acctccgatcagcacccgtggtttcagcgggcgcggcgcgctccgaagggctcggcccgg
cgcgacttctacgtctggagcgacgacccgcacaagtacgagggcacgcgcatcatcttc
accgacaccgagacctcgaactggtcctgggacccggtcgccgagcagtactactggcac
cgcttcttcagccaccagcccgacctcaaccacgacaacccgcaggtcttcaaggccata
atgaacgtgatgcgcttctggctcgacgccggggtggacgggctgaggctcgacgccatc
ccctacctcatagagcgcgaggggaccgacaacgagaacctcccggagacgcacgaggtc
ctgaagaggatgcgcgccgagatggacgcgagctacgaggaccggctctttctcgccgag
gcgaaccagtggcccgaggacgttctgccgtacttcggggacttcgaggccggcggcaac
gagtgccacatggcctttcacttcccgcttatgccgaggatctacatggccgtcgcgcag
gaggaccggcacccaatagtcgagatcatgcagcaaacacccgagatcccgtcgagttgc
cagtgggcgatcttcctcagaaaccacgacgagctgaccctggagatggttaccgacaaa
gagcgcgactacatgtacgagacctacgcctcggacccgcgcgcccggataaacgtcggt
atccgccgccgcctcgcgccccttctcgacaacgaccggccgaaaatagagctgctgaac
agcctgctcatgagcatgccggggaccccgatcatctactacggcgacgagctcggtatg
ggcgacaacatctacctcggcgatcgggacgccgtcaggaccccgatgcagtggaccgcc
gaccggaacgccgggttctcgaaggccgacccccagaggctctacctgcctccgatcatg
gactccgtctacggctacgagtcaatcaacgtcgaggctcagtcccgcaacgccggatcg
ctcctgaactggatgaagcgtctcataaacgtgcgtaaatcatacaaagccttcgggcgc
ggggagctagagtttctgcaccccggcaaccggcgggtgcttgcctacctgcgaaggtac
gagggagcggacggcgagacggaggacatcctgtgcatcgcgaacctctcgcgatcggcg
cagccggtcgagctggaccttgcgcgtttctcggggcgggtgccggtggagctgatgggc
gggacgagcttcccgccggtcggggctctgccgtacttcatcacgcttcccggatacggg
ttctactggttcgagctctcgaaggaggttgcggccccgaggtggcaccaggaatcgccg
aaggtcgtcgagatgccggtcgtcgtgcttccggccgggagacagccctcaagcgagatc
aagcgcgcactccccctgcgtatcccttcgaggcaggtctcgctgcttgagaaggaggcg
ctcgccaacttccttgaggcccggcgctggttcgccgggaagagcgccggaataagcagg
gtgcaggtcgcctcgcaggccgagctcggcggagaccggctcctaaccgttctctccgtc
gaggtcgccgaggggcgggagaacgggggggagccggagcgccagctctacttcctgccg
ctctccgccggctgggaggacgagatcggcgaggaggggatagacggcctcctgcagcac
tcgctcgccaagcttcggcgccggagcaggaccgggatgctctatgacgccctcgcagac
gaggtgttctgccgggaggttgtccgggcgatgggcgagggagtcagcatccccatgggc
gagggacgcgtccgcttcgaggcgaccggtcgctacgaggagcttctcggggatgaggac
ctctccgagctctccgtaaggaagtcgtccgtggagcagtcaaacacctcggtcattatc
ggggagcgggtcatgctcaaggcctaccggcgtcttgaggaaggcgagaacccggaggtc
gaggtcgggcgcttcctcaccgaggtcgccggcttcgagcacaccccgccgctcgtcggc
acggtcgagtacgagggagaggacggcggcaggacggcgttcgcgatcctccagggcttc
gtacacagccagggcgacggctggtcctacgtcctcgactacctcgaacgctacctcgac
gaccggacgaccacgacctggagcctgccggacggcgaccgagaggacgagacccaggag
ttccacgaggccgacgacgcctttttcgacgggctgatgcataacctcgggctccgcacc
ggggagcttcacgccgtgctcgccggagaggtcgccgcccggaccggcgacccggctttc
gtccccgaaacggcctcccccgaagaggtcgagggctgggcgagcgcggtcggggaggac
ctgaagcggacctttgagcttctcaagcgccgccgggagaggcttccggaagaagcgttg
ccggcggtcgaagcgcttcttgagcgcaagaaggaggtcaaggcgcttgtaaaggaggtc
aagagcgccgcgaaggagggcctcacggcggtgaagtcgcggcatcacggcgactaccac
ctcggacaggtgctcgtggtgaacaacgacttccagatcatcgacttcgagggcgaaccg
gcccgctcgctcgaagagcgccggcgcaaggcctcgccgctccgggacgttgccgggatg
cttcgctccttcgactacgctgcaaaaaccgctctctccgagaaccccgaggaggcgaag
gagatctcctactggaccgaggagtggctcaagcgcacgaggaggtcctttctctcgggt
tacaccgagggcgcggccggggtctacggcgatgaggagtcggcgcgcaagctcacggac
ctcttcgttgtcgagaaggctctgtacgagatccgctacgagctcgacaaccgcccggac
tgggtgacgatccccgtccggggcatccttgacctgatcggcaacggggaggaactcagt
tga

DBGET integrated database retrieval system