KEGG   Rubrobacter radiotolerans: RradSPS_0325Help
Entry
RradSPS_0325      CDS       T03080                                 

Definition
Phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rrd  Rubrobacter radiotolerans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rrd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RradSPS_0325
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    RradSPS_0325
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RradSPS_0325
Enzymes [BR:rrd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     RradSPS_0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
Position
345212..347047
Genome map
AA seq 611 aa AA seqDB search
MGDGGLSGWDEFFLSRKDFLRYSVAGTVAVWAGTAAPGGLGVSEAEARDLFAVRRVNPAL
FPQSVASGDPRPDGIVLWTRIASRATGTQRVAYEVARDARFRSKVLRGVAQTGRGRDYTV
KVQLRRRELEPFTTYYYRFIFNGNASRTGRFKTLPAAGADIERLRFGYLSCQDYTNGYYT
ALAYLAEEDLDFVVHLGDYIYETTAAEEFQGGGPPERAIPRLPSGNPQAETLADYRFLYR
KYKTDTNLQRVHERFATITIWDDHEFANDCHQVWDTDREATKEDQTRPGTPNYAPLRREN
ANRAWAEFVPAGVPYDASKGPLEEIRIYRTFKFGNLLELVMTDERLYRDEHPCGPNTPDK
YVTPGCGAEATGDQSMLGETQKRWFLDRIKGSTSRWKLWGNETMVMEFKQAGAALPEELG
IERDAKVYVNLDQWDGFQREREEILREIKSAGVEDFVIITGDIHSYLAGYAKLDYNDQLP
LAADGENIAGVCFVCGSITSSNLVELATRGQGNRLFGVNSGAFSAGITANNPHIQFFSSE
SHGYNLMDVTPERIVCTMKEVSTIRQPRATLRTLKVFEVASGTNTITDVTPAAPPRVFSP
QELGEAQEVGS
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
ttgggcgacggcggcttgtctgggtgggacgagttctttctttcacgcaaggatttcctg
cggtactcggtggccgggacggtcgcggtctgggccgggacggcggctccgggcgggctc
ggcgtcagcgaggcggaagcgcgggaccttttcgccgtccggcgggtcaacccggccctc
tttccgcagagcgtcgcctcgggcgacccgcgtccggacggcatcgtgctctggacgcga
atagcctcgcgggctacgggtacgcagcgcgtcgcctacgaggtcgcgcgcgacgcgagg
ttccgctcgaaggtgctgcgcggcgtcgcccagacgggtcgcgggcgcgactacaccgtg
aaggtccagctccgacgccgggagcttgagcccttcacgacctactactaccggtttatc
tttaacggcaacgcgagccgcaccgggcgcttcaagacgctcccggcggccggggccgac
atcgagcggctgcgcttcggctacctctcttgccaggactacacgaacggctactacacc
gcgctcgcctacctcgccgaggaggacctggacttcgtggtgcacctcggggactacatc
tacgagacgaccgccgccgaggagttccagggcggcggacctcccgagcgggcgatcccg
cgcctcccgagtggcaatccacaggccgagacgctcgccgactaccgcttcctctaccgg
aagtacaagaccgacacgaacctgcaaagggtccacgagcggttcgccacgatcacgatc
tgggacgaccatgagttcgcgaacgactgccatcaggtctgggacacggacagggaggcg
acaaaggaggaccagacccggcctggcacccccaactacgcgccgctccggcgggagaac
gcaaaccgggcgtgggccgagttcgtgccggccggggtcccctacgacgcatcgaaaggg
cctctggaggagatccgcatctaccgtaccttcaagttcggcaacctcctggagctcgtg
atgaccgacgagcggctctaccgcgacgagcacccctgcggcccgaacacacccgacaag
tacgtaacccccggctgcggcgcggaggccaccggagaccagagcatgctcggcgagacg
cagaagcggtggtttctcgaccggataaagggctccacgagccggtggaagctctggggc
aacgagacgatggtcatggagttcaagcaggccggggcggcgctaccggaggagctcggc
atcgagcgcgacgcgaaggtctacgtgaacctcgaccagtgggacgggtttcagcgggag
cgggaggagatcctccgggagatcaagtccgcaggcgtagaggacttcgtgatcatcacc
ggagacatccactcctaccttgcgggctacgcaaagctcgactacaacgaccagctcccg
ctcgccgccgacggggagaacatcgccggggtctgctttgtgtgcggctccatcacctcc
tcgaacctcgtcgagctcgcgacccgggggcaggggaaccggctcttcggggtgaactcg
ggagcgttcagcgcggggatcacggcaaacaacccgcacatccagttcttctcctcggag
tcgcacggctacaacctcatggacgttacgccggagaggatcgtctgcacgatgaaggag
gtctcgaccatccgccagccgcgcgcgacgctccggaccctgaaggtcttcgaggtcgcc
tcggggacgaacaccatcacggacgtaactcccgccgctccgccccgggtcttctccccg
caagaactcggagaagcacaggaggtcgggtcgtga

DBGET integrated database retrieval system