KEGG   Rubrobacter radiotolerans: RradSPS_0350Help
Entry
RradSPS_0350      CDS       T03080                                 

Definition
GABAtrnsam: 4-aminobutyrate transaminase (EC:2.6.1.19 2.6.1.22)
Orthology
K07250  
4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
rrd  Rubrobacter radiotolerans
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrd00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    RradSPS_0350
   00650 Butanoate metabolism
    RradSPS_0350
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    RradSPS_0350
   00280 Valine, leucine and isoleucine degradation
    RradSPS_0350
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    RradSPS_0350
Enzymes [BR:rrd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     RradSPS_0350
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     RradSPS_0350
Amino acid related enzymes [BR:rrd01007]
 Aminotransferase (transaminase)
  Class III
   RradSPS_0350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
376109..377422
Genome map
AA seq 437 aa AA seqDB search
MLKSTQIKTEVPGPKSRELQERRKKAISSGLGTAIPIWAAEAEGALVTDVDGNVFIDFGG
GIGVLNAGHNHPKVVRAVKEQAEKLIHSCYYATQYEPYLLLAEKLNEIVPGSYEKRSFLV
NSGAEAVENAVKISRAYNRKPGVLAFENGFHGRTLLAATLTAKANPYKQSFGPFAPEVYR
VPAPYPYRYPEDWFRSFKRALANIDVTSIGCAIVEPVQGEGGFHPWPKEDLEKLAAWCRE
MEIVLIVDEVQSGFGRTGKMFAIEHFDVEPDIVTTAKSMGGGMPISGVTGRAEIMDSVHP
GGIGTTYGGNPVSCVAALAVIEAYEEDDLLGRAEALGERLLSGLKEIQRENPGFVGEARG
LGPMAGLEFVKDAQTKEPDADGTKQVVANALQEGLMLLTAGGYGNVIRTLMPLVITDDQL
DEGLAILSRAVAEAAGK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctcaagtcgacacagataaagacggaggtgcccggtccgaagagccgcgagttgcag
gagcggcgcaagaaagctataagctccgggctcgggacggcgatcccgatctgggcggcg
gaggccgagggcgcgctcgtcacggacgtggacgggaacgtctttatagacttcgggggc
ggcatcggggtgctgaacgccgggcacaaccacccgaaggtcgtccgggcggtaaaggag
caggcggagaagctgatccactcctgctactacgcgacgcagtacgagccgtatctgctc
ctcgcggagaagctgaacgagatcgtccccgggagctacgagaagcgctccttcctcgta
aactccggggccgaggcggtcgagaacgcggtcaagatcagccgcgcctacaaccgcaag
ccgggcgttcttgccttcgagaacggctttcacggaaggacgctcctcgccgcgaccctg
acggcgaaggcgaacccctacaagcagagcttcggaccgttcgctccggaggtctaccgc
gtccccgcgccgtacccgtaccgctacccggaggactggttccgctcgttcaagcgcgcg
ctcgcgaacatcgacgtaacgagcatagggtgcgcgatcgtcgagccggtgcagggcgag
ggcggcttccatccctggccgaaggaggacctggagaagctcgccgcctggtgccgggag
atggagatcgtccttatcgtggacgaggtccagagcggcttcggccggacgggaaagatg
ttcgccatcgagcacttcgacgtcgagccggacatcgtgacgaccgccaagagcatgggc
ggcgggatgccgataagtggcgtaacggggcgagcggagatcatggacagcgtccacccc
ggaggcatcggcacgacctacggcggcaacccggtctcctgcgtggcggcgctcgccgtt
atcgaggcctacgaggaggacgacctcctcgggagggccgaggcgctcggcgagcggctc
ctctcgggactcaaggagatacagcgcgagaaccccggcttcgtcggtgaggcgcgcggc
ctcggcccgatggccggtcttgagttcgtgaaggatgcgcagacgaaggagcccgacgcg
gacggcacgaagcaggtcgtcgcgaacgcgcttcaggaggggctgatgctgctcacggcc
ggaggttacgggaacgtgatccgcaccctcatgccgctcgtcataaccgacgaccagctc
gatgaggggctcgccatcctctcacgcgccgtcgcggaagccgccggaaagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system