KEGG   Rickettsia rhipicephali: MCC_00235Help
Entry
MCC_00235         CDS       T01786                                 

Definition
oxidoreductase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rre  Rickettsia rhipicephali
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:rre00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:rre00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(34853..35404)
Genome map
AA seq 183 aa AA seqDB search
MKEFGKIDILVNNAGIQHVAPIGEFSEDKWEQILRIDLIASFYTTKYAIQIMKKNGFGRI
INIASAHAYVASPFKSAYVAAKHGILGLTKTVALEVAENNITVNAICPGYVNTPLVRNQI
ADTAKARHISEESALRDVILKSQATKKFVEADGIANLVIFLCDEKASSITGSGLLIDGGW
TAQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattcggtaaaatagacatattagtaaataatgcaggtattcagcatgttgct
cctatcggtgaattttctgaagataaatgggagcaaattttgcgtatagatttaatagca
tctttctatactacaaaatacgcaatacagattatgaaaaaaaacggcttcgggcgaatt
attaatatcgcttccgctcatgcatatgtcgcatcacccttcaagtcggcatatgtagca
gcaaagcacggtatccttggacttaccaaaaccgttgctttagaagtggctgagaataat
attacagttaatgctatctgtcccggttacgtcaacacacccttagtaaggaatcaaata
gcagatactgctaaagctagacatatcagtgaagaatcagcgttaagggatgtaatcctt
aaatctcaagctacgaaaaaatttgtagaagctgatggaatagcaaacttagtaatattc
ttatgtgacgaaaaagcttcatcaataacaggtagtggactcttgatagatggcggctgg
acggcacagtag

DBGET integrated database retrieval system