KEGG   Rickettsia rhipicephali: MCC_00235Help
Entry
MCC_00235         CDS       T01786                                 

Definition
oxidoreductase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rre  Rickettsia rhipicephali
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rre00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MCC_00235
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    MCC_00235
Enzymes [BR:rre01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     MCC_00235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(34853..35404)
Genome map
AA seq 183 aa AA seqDB search
MKEFGKIDILVNNAGIQHVAPIGEFSEDKWEQILRIDLIASFYTTKYAIQIMKKNGFGRI
INIASAHAYVASPFKSAYVAAKHGILGLTKTVALEVAENNITVNAICPGYVNTPLVRNQI
ADTAKARHISEESALRDVILKSQATKKFVEADGIANLVIFLCDEKASSITGSGLLIDGGW
TAQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattcggtaaaatagacatattagtaaataatgcaggtattcagcatgttgct
cctatcggtgaattttctgaagataaatgggagcaaattttgcgtatagatttaatagca
tctttctatactacaaaatacgcaatacagattatgaaaaaaaacggcttcgggcgaatt
attaatatcgcttccgctcatgcatatgtcgcatcacccttcaagtcggcatatgtagca
gcaaagcacggtatccttggacttaccaaaaccgttgctttagaagtggctgagaataat
attacagttaatgctatctgtcccggttacgtcaacacacccttagtaaggaatcaaata
gcagatactgctaaagctagacatatcagtgaagaatcagcgttaagggatgtaatcctt
aaatctcaagctacgaaaaaatttgtagaagctgatggaatagcaaacttagtaatattc
ttatgtgacgaaaaagcttcatcaataacaggtagtggactcttgatagatggcggctgg
acggcacagtag

DBGET integrated database retrieval system