KEGG   Rickettsia rhipicephali: MCC_01490Help
Entry
MCC_01490         CDS       T01786                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rre  Rickettsia rhipicephali
Pathway
rre00020  Citrate cycle (TCA cycle)
rre00190  Oxidative phosphorylation
rre00650  Butanoate metabolism
rre01100  Metabolic pathways
rre01110  Biosynthesis of secondary metabolites
rre01120  Microbial metabolism in diverse environments
rre01130  Biosynthesis of antibiotics
rre01200  Carbon metabolism
Module
rre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rre_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rre_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rre00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCC_01490
   00650 Butanoate metabolism
    MCC_01490
  Energy metabolism
   00190 Oxidative phosphorylation
    MCC_01490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS tRNA_anti_2 PAP2 Fumarate_red_D Voltage_CLC Mem_trans
Motif
Other DBs
NCBI-ProteinID: AFC71951
Position
250995..251369
Genome map
AA seq 124 aa AA seqDB search
MVYDFKAAIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWE
LKKPFNVVVLLITVVISLYHAMLGMRVVIEDYISCHKLRNTLIIIVQLFCIVTIVAFVTM
FYKG
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagcaattgtaaaagcaaaaaatagcggttctgctaaaagt
ggttctcatcattggttattgcaaagagtaacggggattatattagctttatgttctgtg
tggctaatatattttacgttaaccaacaaaaataatgatataaatattattatgtgggag
cttaaaaagccttttaatgtagtagttttgttaattacggtggttatttcgttgtatcat
gcgatgcttggtatgcgtgtagtaattgaggattatataagttgtcacaaattacgtaat
acattgattataatagtgcaattattttgcattgtgactattgtagcttttgtaacgatg
ttttataaaggataa

DBGET integrated database retrieval system