KEGG   Rickettsia rhipicephali: MCC_01820Help
Entry
MCC_01820         CDS       T01786                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rre  Rickettsia rhipicephali
Pathway
rre00020  Citrate cycle (TCA cycle)
rre00310  Lysine degradation
rre01100  Metabolic pathways
rre01110  Biosynthesis of secondary metabolites
rre01120  Microbial metabolism in diverse environments
rre01130  Biosynthesis of antibiotics
rre01200  Carbon metabolism
Module
rre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rre_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rre00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCC_01820
  Amino acid metabolism
   00310 Lysine degradation
    MCC_01820
Enzymes [BR:rre01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MCC_01820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFC72007
Position
complement(317243..318442)
Genome map
AA seq 399 aa AA seqDB search
MSVKIIVPSLGESVTEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVNVPCNGTIGKIS
KTDGANVAVGEEIGEINEGAAANTAGTHNESAKAQAATQPTSEKPVEKPAVANNTLAPSV
QKLVTENKLDPNNIKGTGRDGRITKGDVLETINTTATSAPAISKSNEERVQRVRMSRLRK
TIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHAVKLGFMSFFVKATIEAL
KLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADKMGFAEVEKAIGILAKKA
REGKLFMADLSGGTFSISNGGVYGSLFSTPIINPPQSGILGLHKTEERAVVIDGKIEIRP
MMYIALSYDHRIIDGKEGVSFLVKIKQLIENPEKLLLDL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttaaaattatagtaccatcacttggggagtccgtaacggaagcaactattgcc
aaatggtataagaaagaaggcgattcggttaaaaccgatgaattactgttagaaatcgaa
accgaaaaagtgactttagaagtgaatgttccttgcaacggtactataggtaaaatatcg
aaaactgacggtgcaaatgtagcagttggcgaagaaataggcgaaataaatgaaggggca
gctgcaaatactgccggtactcataatgaatctgctaaagctcaagcagcgacgcaacct
acttcagaaaagcctgtagaaaaacctgccgtggctaataatactcttgctccttctgta
caaaaattagttaccgaaaataagcttgaccccaataacatcaaaggaacaggtagagac
ggtagaattaccaaaggtgacgtgcttgaaacaataaacactacggctacttctgctcct
gcaataagtaaatctaatgaagaaagagtgcagcgtgttcgtatgtcacgcttgcgtaaa
actattgcacaacgtttaaaagattcacaaaatacagcagctattttgactacttttaat
gaaatcgatatgtcaaaagtaattgctttgcgtaatcaatataaagaagagtttgagaaa
aagcacgctgtgaaacttgggtttatgtctttctttgttaaagcaacaattgaagcttta
aagcttattccgtcggtaaatgctgaaatagacggcgatgatttagtatataaaaattac
tatgatataggtgtagctgtcggaacagagcaagggcttgttgtaccggttgttagggat
gccgataaaatgggatttgccgaagtggagaaagctataggaattttggctaaaaaagct
cgtgagggtaagctttttatggctgatttgtcaggtgggacattctcgatttctaacgga
ggcgtatatggctcattattctctacacctattattaatcctcctcaatcaggtattcta
ggcttacataaaaccgaggaaagagctgtagttatagacggtaaaattgaaatacgtccg
atgatgtatatagctttatcttacgatcatcgtataattgacgggaaagaaggagtatcg
ttcttggtaaaaattaagcagcttattgagaatcctgaaaagttattgttagatttgtaa

DBGET integrated database retrieval system