KEGG   Rickettsia rhipicephali: MCC_03520Help
Entry
MCC_03520         CDS       T01786                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rre  Rickettsia rhipicephali
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rre00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
602332..602901
Genome map
AA seq 189 aa AA seqDB search
MSKPTREEAKEAVRTLLKFIGEDPSREGLLKTPDRVINSYAEIFSGYGKDVAKILNTKFY
ETCNFQDFILLNIKFTSFCEHHILPFNGTVDIAYVPDNCIVGISKLARIVNIFARRLQIQ
EKMTVQIAESVQENLKPLGVAVKISAVHSCMSMRGVMQDNSVMNTMHYTGIFAEQQKYRH
EFLNLTAKR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaccaactagagaagaagctaaagaggcagtaagaacgttactaaaattcatt
ggtgaagatccaagcagagaagggctgcttaaaacgcctgatagagtaattaatagctac
gcagaaatattttccggttatggaaaggatgtagcaaaaatattaaataccaagttttat
gaaacttgtaattttcaagattttatcttactgaatataaaatttacttctttctgtgaa
catcatatattaccttttaacggtacagtagatatagcttatgttcctgataattgtatt
gtcggcataagtaagctagcacgaatagtaaatatttttgctagaagactacaaatccaa
gaaaaaatgacggtacagatagcagaaagcgtgcaggagaatttaaagccgcttggcgtt
gccgttaagatttctgctgtacatagctgtatgtcaatgcgtggcgtaatgcaagataat
agcgttatgaataccatgcattatacgggtatatttgccgaacagcagaaatatcgtcat
gagtttttaaaccttactgctaaaagatga

DBGET integrated database retrieval system