KEGG   Rickettsia rhipicephali: MCC_03960Help
Entry
MCC_03960         CDS       T01786                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
rre  Rickettsia rhipicephali
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:rre03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
679409..680014
Genome map
AA seq 201 aa AA seqDB search
MNETNDNDIDQLIYLFSKLPGLGSRSARRIALYLLQDKEVRLKSLINNLVEIDKKILKCE
ICGNMDTENICRICSSEYRDKSIIAIVETVAELWAMERSGNFKGLYHVLGHNLSAASRQN
PSILRLPELLKRCFAENIKEVIIATNSTLEGQTTAYFITEYLKEHPAKISRLASGIPIGG
ELDYLDEGTVSAAINLRQPFE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaacaaatgataatgatatagatcagctaatttatcttttttcaaaattaccc
ggtcttggtagtagatcggcaaggcgtatagcgctttacctattgcaagataaagaagta
aggttaaaaagcctgattaataatcttgtagagatagataagaaaatactaaaatgcgag
atttgcggtaatatggatacggaaaatatttgccgtatttgttcttctgaatatagagat
aaatcaattattgctattgttgaaacagtggctgaattatgggcaatggagcgtagcggt
aattttaaaggtttatatcatgtactcggtcataatttatcggcagctagtagacaaaac
cctagcatacttcggttacctgaactacttaaaagatgttttgcagaaaatattaaagaa
gttattattgctactaattctactttagaaggtcagactactgcttattttattacagaa
tatttaaaagagcatcctgctaaaatttctcgccttgctagcggtatacctatcggaggt
gaacttgattatttagacgagggtaccgtatctgccgctattaacctacgccaacctttt
gagtaa

DBGET integrated database retrieval system