KEGG   Rhodospirillum rubrum F11: F11_00105Help
Entry
F11_00105         CDS       T02006                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    F11_00105
  Metabolism of other amino acids
   00480 Glutathione metabolism
    F11_00105
Enzymes [BR:rrf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     F11_00105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(25849..26355)
Genome map
AA seq 168 aa AA seqDB search
MSPLYDIEVTTLDGAPQTLADYAGKVLLIVNVASKCGFTPQYKGLEALQRRYRDRGFCVL
GFPCNQFGHQEPGDAGEIKSFCTLTYDVSFPMFAKIDVNGPDAHPLYRLLKAEAKGLLGS
EAIKWNFTKFLVSADGETISRFAPTDTPESLRARIEALLPAAQGPLGA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgctttacgacatcgaagtcaccaccctcgacggcgctccccaaaccctggcc
gactatgccggcaaggttctgctgatcgtcaatgtcgccagcaaatgcggcttcaccccc
cagtacaagggactggaagccttgcagcggcgctatcgggaccgggggttttgcgtgctc
ggcttcccctgcaaccagttcggccatcaggaacccggcgacgccggggagatcaaatcc
ttctgcacgctgacctatgacgtcagcttcccgatgttcgccaagatcgacgtcaacggc
cccgacgcccatccgctctatcgcctgctcaaggcggaggccaaggggctgctgggcagc
gaggcgatcaaatggaacttcaccaagttcctggtcagcgccgatggcgagaccatctcg
cgcttcgcccccaccgacacccccgaaagcctgcgcgcccgcatcgaagcgctgctgcct
gccgctcagggccccctaggagcttaa

DBGET integrated database retrieval system