KEGG   Rhodospirillum rubrum F11: F11_00105Help
Entry
F11_00105         CDS       T02006                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rrf00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:rrf00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(25849..26355)
Genome map
AA seq 168 aa AA seqDB search
MSPLYDIEVTTLDGAPQTLADYAGKVLLIVNVASKCGFTPQYKGLEALQRRYRDRGFCVL
GFPCNQFGHQEPGDAGEIKSFCTLTYDVSFPMFAKIDVNGPDAHPLYRLLKAEAKGLLGS
EAIKWNFTKFLVSADGETISRFAPTDTPESLRARIEALLPAAQGPLGA
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgctttacgacatcgaagtcaccaccctcgacggcgctccccaaaccctggcc
gactatgccggcaaggttctgctgatcgtcaatgtcgccagcaaatgcggcttcaccccc
cagtacaagggactggaagccttgcagcggcgctatcgggaccgggggttttgcgtgctc
ggcttcccctgcaaccagttcggccatcaggaacccggcgacgccggggagatcaaatcc
ttctgcacgctgacctatgacgtcagcttcccgatgttcgccaagatcgacgtcaacggc
cccgacgcccatccgctctatcgcctgctcaaggcggaggccaaggggctgctgggcagc
gaggcgatcaaatggaacttcaccaagttcctggtcagcgccgatggcgagaccatctcg
cgcttcgcccccaccgacacccccgaaagcctgcgcgcccgcatcgaagcgctgctgcct
gccgctcagggccccctaggagcttaa

DBGET integrated database retrieval system