KEGG   Rhodospirillum rubrum F11: F11_00715Help
Entry
F11_00715         CDS       T02006                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    F11_00715
Enzymes [BR:rrf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     F11_00715
Exosome [BR:rrf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   F11_00715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(164512..165495)
Genome map
AA seq 327 aa AA seqDB search
MSAIFPVTRMRRLRRSVALRDLVRETTVSTNDLIQPIFVEEEIDSPIPIPTMPGISRIPE
QHLAAEIEALARLGLKSVMLFGISHHKDHCGSDTWNPDGLVARMLRTAKHAVPDMVVIPD
ICFCEYTDHGHCGVLDQGHVANDATLANLVKQAVVAAESGADILAPSGMMDGQVQAIRAG
LDKAGFLEIPIMAYASKFESALYGPFRVASECTLQGNRKTYQLDPMNGRAALREALLDEA
EGADFLMVKPGTLYLDVLHQLRQRTLLPLAAYQVGGEYAMIKFAALSGALDERSTVLETL
GAFKRAGADLIVSYFARDVARCLDGRA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccatctttccggttacccgcatgcgccgactgcgccgttccgtcgctttgcgg
gaccttgtccgagaaaccacggtttcgacgaacgatttgatccagcccattttcgttgag
gaggagattgactcgccaatccccatcccaacgatgccgggaatctctcggatccccgaa
cagcacttggcggccgagatcgaagccctcgcccgcctggggttgaaatcggtgatgctg
tttggcatctcgcaccacaaggatcattgcggcagcgacacctggaacccggacgggttg
gtggcacggatgttacggacggcgaagcacgctgtgccggacatggtggttattcctgac
atttgcttttgtgagtacacggaccatggtcattgcggcgtgctagaccagggccatgtc
gcgaacgacgccacgctggccaacctcgtgaaacaggccgttgtcgccgccgagtcggga
gcggacatcctggcgccatcgggcatgatggatggtcaggtccaggccattcgtgccgga
ttggataaagccggcttcctggaaatcccgattatggcctatgcctcgaagttcgagtcc
gccctctacggacccttccgcgtagccagcgagtgtaccttgcagggcaaccgcaagacc
taccaactcgatccgatgaacggtcgggccgccctccgggaagccctcttggacgaagcg
gaaggagctgattttctcatggtgaagcccggcacgctctacctcgatgtgcttcatcag
ctgcgccaacgcaccttgctgccgctcgccgcctatcaggtggggggggagtacgccatg
atcaaattcgccgccctttccggcgcccttgacgaacgctcgacggtgcttgagaccctg
ggggcgttcaagcgcgcgggcgccgatctcatcgtcagctatttcgcccgcgacgtcgcg
cgctgcctggacggacgggcctga

DBGET integrated database retrieval system