KEGG   Rhodospirillum rubrum F11: F11_02195Help
Entry
F11_02195         CDS       T02006                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    F11_02195 (gmk)
Enzymes [BR:rrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     F11_02195 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
501508..502164
Genome map
AA seq 218 aa AA seqDB search
MSAPSSAPALIPRRGMMLVLSSPSGAGKTTISRALLAEEDGLEMSVSVTTRAPRPGERDG
EHYHFIDVARYMALTKDDGLLEHARVFENYYGTPRAPVEAALARGCDVLFDIDWQGTQQV
AEKARTDLVSIFILPPSVGELERRLKGRAQDSDAVVAARMAKAMDEISHYFEYDYIIVND
DLDRSIADVRAILRAERLKRARRIGLAEFVNRMRGAGE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccccttcctccgcccccgccctcatcccccggcgcggtatgatgctggttctc
tcctcgccttccggggcggggaagaccactatttcccgcgctcttctggccgaagaggac
ggattggagatgtcggtgagcgtcaccacccgggcgccgcggcccggtgaacgcgacggc
gagcattaccatttcatcgacgtcgcccgttatatggccttgaccaaggacgacggccta
cttgaacacgcccgggttttcgaaaactattacggtaccccccgggcgccggtcgaggcg
gccctggccaggggctgtgacgtcttgttcgatatcgattggcagggcacccagcaggtg
gccgaaaaggcgcggaccgatctggtcagcatcttcatcctgccgccctcggtgggggaa
ctcgaacgccggctgaagggcagggcccaggatagcgatgccgtggtggcggcgcgcatg
gccaaggcgatggacgagatcagccactacttcgaatacgattacatcatcgtcaatgat
gatctcgaccgctcgatcgccgatgtgcgggccatcttgcgggccgagcgcctgaagcgc
gcccgccggatcggtctggccgaattcgtcaaccgcatgcgcggcgccggggaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system