KEGG   Rhodospirillum rubrum F11: F11_02490Help
Entry
F11_02490         CDS       T02006                                 

Definition
protoporphyrin IX magnesium-chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rrf00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
569065..570087
Genome map
AA seq 340 aa AA seqDB search
MAVFPFSAIVGQDEMKLALLIAAVDPSVGGVMVFGDRGTGKSTAVRALAALLPPMQATVG
CPYGCDPEADAKTCVPDCPRHGPGGAQAESRPVPVIDLPLGATEDRVVGALDLERALARG
EKAYEPGLLARANRGFLYIDEVNLLEDHLVDLLLDVAASGVNVVEREGLSIRHPARFVLV
GSGNPEEGELRPQLLDRFGLSVEVRTPDQLATRVLVVRRRDSYESDPDAFVAEWQAADGD
ERNRISAAREGLKSISVSDDIVEKCAELCLKLGTDGLRGELTLVRAARALAALQGDKAVT
LDHLKRVAPSALRHRLRRDPLDEAGSTIRVQRGIEAVLGS
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggcggttttcccgttttcggccatcgtcggccaggatgagatgaagctggcgctgctg
atcgccgccgttgatccgtcggtgggcggtgtcatggtgtttggcgatcgcggtacgggt
aaatccaccgccgtgcgcgccctggccgctctgctgccgccgatgcaagccacggtcggc
tgcccctatggctgcgaccccgaggccgatgccaagacctgcgttcccgattgtccgcgc
catgggccgggcggcgcccaggccgaaagccggccggtgccggtgatcgatttgcctttg
ggcgccaccgaagaccgcgtggtcggggcgctcgatctggaacgcgccctggcgcgcggt
gaaaaagcctatgagccggggctgctggcccgggccaatcgcggcttcctgtatatcgac
gaagtgaacctgctcgaagaccatctggtcgatctgctgctcgatgtcgccgcctcgggc
gtcaatgtcgtcgagcgcgaagggctgtcgatccgccatcccgcccgtttcgtgctggtg
ggcagcggcaaccccgaagagggcgaattgcggccgcagcttcttgaccgcttcggtctg
tcggtcgaggtgcgcacccccgatcagttggcgacccgggttctggtggtccgccgccgg
gattcctatgaaagcgatcccgacgccttcgtcgccgaatggcaagccgccgatggcgat
gagcgcaaccgcatcagcgcggcgcgcgagggtttgaaatcgatcagcgtcagcgatgat
atcgtcgagaaatgcgccgagctgtgcctgaagctgggcaccgatggtctgcgcggcgaa
ctgaccctggtccgcgccgcccgcgccctggccgccctgcagggcgacaaggccgtgacc
ctggaccatctgaagcgggtcgccccctcggccctgcgtcaccgcctgcggcgcgatcct
ttggacgaggccggctctaccattcgcgttcagcgcgggatcgaggccgttctcggatca
tga

DBGET integrated database retrieval system