KEGG   Rhodospirillum rubrum F11: F11_02495Help
Entry
F11_02495         CDS       T02006                                 

Gene name
bchD
Definition
magnesium chelatase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rrf00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
570084..571901
Genome map
AA seq 605 aa AA seqDB search
MTAPAAFNPLTWDEAARAAAMVAVDPVGLGGAVIRALPGPPRDRWLAYLRELLPADAPLR
RMPLHISDDRLLGGLDLAATLRAGRPVAQRGLLAEAHNGIVVLAMAERAPVGTVAQLCSV
IDCGEVRTERDGLGLRSPAHLGVVALDEGLEEDEHPLASLVDRLAISLDLGPLRDLSDDG
ELPDADMVQAARENLGAVTIPETLIETLCATAAAFGILSLRVPLFALRVARTAAALDGRT
AVEDADIMTAVRLVLAPRALVLPMPPEDDAEDQPPPPPPPEEPPESEPEQKKDQDDQGGP
TLEEMAVAAAAAIMPAGMLARLRAAGGLRRKVTPPGKAGALKAAKTRGRPAGTRPGAPGP
GARLSVIDTLRAAAPWQRVRRDEEAARLGDEGVPPAEGGPAGPRVLVRPDDFRVTRLRQR
AQTTTIFVVDASGSSALHRLAEAKGAVELLLADCYVRRDQVALVAFRGARADVLLPPTRS
LVRAKRSLQRLPGGGGTPLASGLDAATALAELCQRRGETPVLVVLTDGRANVGRDGTGGR
AKAEADAQSAARALRAMGLGVLLVDTAPRPDPRARKLAEELDACYLALPHADAMAISQGV
RAAMT
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgccggccgcctttaacccgctgacctgggacgaggcggcccgcgccgcggcc
atggtcgccgtcgatccggtcggcctgggcggcgcggtgatccgcgccctgcccggaccg
ccgcgcgaccgctggctggcctatctgcgcgagctgctgcccgccgacgcgcctttgcgc
cggatgcccctgcatatctccgacgaccgcctgctcggcggtctggatctggccgcgacc
ctgcgcgccggtcggccggtggcccagcgcggcctgctggccgaggcccataacggcatc
gtcgtgctggcgatggccgagcgcgccccggtgggcaccgtggcccaactgtgttcggtg
atcgattgcggcgaggtgcgcaccgaacgcgatggccttggcctgcgctcgcccgcccat
ctcggcgtggtggcgctggacgagggactggaggaggacgagcatcccctggcctcgctg
gtcgatcgtctggcgatctcgcttgatcttggacctttgcgcgatctgtccgacgatggc
gaactgcccgatgccgatatggttcaggccgcccgcgagaacctgggcgccgtcaccatt
cccgagaccttgatcgaaacgctgtgcgccacggcggcggcctttggcattttgtcgctg
cgcgtgccgctgttcgcgctgcgggtggcccgcaccgccgccgccctggatgggcggacg
gcggtcgaggacgccgatatcatgacggcggtgcggctggtgctggcgccgcgcgccctg
gtgctgccgatgccgcccgaggacgacgccgaggatcagccgcccccgccgcccccgccc
gaggagccccccgagtccgagcccgaacagaaaaaggaccaggacgatcagggcggtccg
acgcttgaggaaatggccgtcgccgccgccgccgccatcatgccggcgggcatgctggcc
cgcctgcgcgccgccggcggcttgcgccgcaaggtcacgccaccgggcaaggccggggcg
ctcaaggccgccaagacccggggccgtccggccggaacccgcccaggcgcgcctggaccg
ggcgcccggctttcggtcatcgataccctgcgcgccgccgccccctggcagcgggtgcgc
cgcgacgaggaggccgcgcgcctgggcgacgagggtgttccgccagccgagggcggcccc
gccggtccgcgtgtgctggtccgccccgatgatttccgggtgacgcgcctgcgccagcgg
gcccagacgacgacgatctttgtcgtcgacgcctcgggatcctcggccctgcaccgcttg
gccgaggccaagggcgcggtggaactgctgctggccgattgctatgtgcgccgcgatcag
gtggccctggtcgccttccgcggggcgcgggccgatgtcttgctgccgccgacgcgctcg
ctggtgcgcgccaagcgcagtttgcagcggctgcccggcggcggcggcacccccctggcc
tcgggcctcgacgccgcgaccgccctggccgaattgtgccagcggcgcggggaaaccccg
gttctggtggtgctgaccgatgggcgggccaatgtcgggcgcgatggcaccggcggccgg
gccaaggccgaagccgatgcccaatcggcggcccgcgccctgcgcgccatggggctgggg
gtgctgttggtcgataccgcgccgcgtcccgatccgcgcgcccgcaaactggccgaagag
cttgacgcttgctacctcgccttgccccacgccgatgcgatggctatatcgcaaggcgtt
cgtgcggcgatgacctga

DBGET integrated database retrieval system