KEGG   Rhodospirillum rubrum F11: F11_02685Help
Entry
F11_02685         CDS       T02006                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    F11_02685
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    F11_02685
Enzymes [BR:rrf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     F11_02685
Two-component system [BR:rrf02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   F11_02685
Bacterial motility proteins [BR:rrf02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    F11_02685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
617675..618838
Genome map
AA seq 387 aa AA seqDB search
MTITTSEATSHTLGGPIRVMVVDDSAVVRGLETRMLEEDPAIQVVASVGNGQMAVQALDR
HDIEVVILDIEMPVMDGLTALPELLRKSPNLKVIMASTLTLRNAEVTLKALQMGASECLA
KPTTSREISGGTDFRHDLVEKVKALGGARRRALGRAAPTARAGGAVVERKVGALPSLMAQ
RAQQPISLRPAAEERPDIIAIGSSTGGPQALFTVFGDMRKGGWPSQPIVVTQHMPATFTT
ILAGHIERVAGVPTAEAKDGDPIRGGHIYIAPGDYHMVVETRGTEKILRLNQDPPESFCR
PAVDPLFRSVAKAYGRRVLAVVLTGMGADGSKGGKIIAESGGTVIAQDEPSSVVWGMPGA
TAQIGACSAVLPLKDIAAYVLRSANKR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgacgataacgacgtccgaagcgaccagccataccctcggcggaccgatccgggtcatg
gtcgttgatgattccgccgtggtgcgggggctggaaacccgcatgctcgaagaggatccg
gccatccaggtcgtcgcttcggtgggcaatggtcagatggcggtgcaagcgctcgaccgg
cacgacatcgaggtggtgatcctcgatatcgagatgccagtgatggacgggttgaccgcc
ttgcccgagttattgcgaaagtcgcccaatctcaaggtgatcatggcctcgaccctgacc
ctgcgcaacgccgaggtcacgctcaaggccctgcagatgggagcctcggaatgtctggcc
aagccgacgacgtcgcgcgagatttcgggggggacggatttccggcacgatctggtggag
aaggtcaaggctttgggcggggcgcggcgccgcgccctgggacgggcggcgccgacggcg
cgggccggcggggccgtggtcgagcgcaaggtcggggctctgccctcgctgatggcccag
cgcgcccagcagccgatctccctgcgtccggcggccgaggagcgccccgatatcatcgcc
atcggcagttcgaccggcggtccccaggcgctgttcacggtttttggcgatatgcgcaag
ggcggttggcccagtcagccgatcgtcgtcacccagcatatgcccgcgaccttcaccacc
attctggccggacatatcgaacgggtggcgggggtgccgacggccgaggccaaggatggc
gatcccattcgcggcggccatatctacatcgcgccgggcgactatcacatggtcgtggaa
acccgggggacggaaaaaatcctgcgattgaaccaggacccaccggaaagcttttgtcgt
cccgccgtcgatccgctgttccgctccgtcgccaaggcctatggccggcgggtgctggca
gtggtgctgaccggcatgggcgccgacggctccaagggaggcaagatcatcgcagagtct
gggggcaccgtgatcgcccaggacgagcccagcagtgtggtgtggggaatgcccggagcg
acggcccagatcggggcctgttccgccgttcttcccctcaaggacattgcggcctacgtt
ctccgatccgcgaacaagcgctga

DBGET integrated database retrieval system