KEGG   Rhodospirillum rubrum F11: F11_05255Help
Entry
F11_05255         CDS       T02006                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    F11_05255
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    F11_05255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1209394..1209801)
Genome map
AA seq 135 aa AA seqDB search
MKKGFLAAGVFAAVAFASGAALAEGDAAAGEKVSKKCLACHTFDQGGANKVGPNLFGVFE
NTAAHKDDYAYSESYTEMKAKGLTWTEANLAAYVKDPKAFVLEKSGDPKAKSKMTFKLTK
DDEIENVIAYLKTLK
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagggtttcctggccgccggcgttttcgccgccgtggctttcgcttccggcgcg
gcccttgccgagggtgatgccgccgctggcgaaaaagtcagcaagaagtgcctcgcctgc
cacactttcgatcaggggggcgccaataaggtcggccccaacctgttcggtgtgttcgag
aacacggccgcccacaaggacgactacgcctattcggaatcctacaccgagatgaaggcc
aagggcctgacctggacggaggcgaacctcgccgcctatgtcaaggatcccaaggccttc
gttcttgagaagtcgggcgatccgaaggccaagagcaagatgaccttcaagttgaccaag
gacgacgagatcgagaacgtcatcgcctacttgaagaccctgaagtag

DBGET integrated database retrieval system