KEGG   Rhodospirillum rubrum F11: F11_05395Help
Entry
F11_05395         CDS       T02006                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
rrf00010  Glycolysis / Gluconeogenesis
rrf00030  Pentose phosphate pathway
rrf00051  Fructose and mannose metabolism
rrf00052  Galactose metabolism
rrf00680  Methane metabolism
rrf01100  Metabolic pathways
rrf01110  Biosynthesis of secondary metabolites
rrf01120  Microbial metabolism in diverse environments
rrf01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F11_05395
   00030 Pentose phosphate pathway
    F11_05395
   00051 Fructose and mannose metabolism
    F11_05395
   00052 Galactose metabolism
    F11_05395
  Energy metabolism
   00680 Methane metabolism
    F11_05395
Enzymes [BR:rrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     F11_05395
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     F11_05395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AEO47549
Position
complement(1240770..1241870)
Genome map
AA seq 366 aa AA seqDB search
MAEIRRIGVLTSGGDCAGLNAVIRAVTHRARRAYGWKVFGILDGTMGLMDRPLRYRELDS
EMFSGFDILRAGGTVLGTVNKGDPFAFPMADGSKTDRSLDFVDGFHSLELDALVVVGGDG
SMRILKKLCDKGSIGMVGVPKTIDNDVHGTEYAVGFSTATNVVTEALDRLQATAASHHRV
MILEVMGRDAGHIAVSAGIAGGADVILIPEIPYTLEGVAKRIREVQQEGRSHALIVVAEG
VLTPEGERATVAYAGGQTRYGGISQYLSDRIAQDTGTETRVTILGHVQRGGIPSMRDRLL
ASAFGVHAVDLVAARKFGRMVAWQDRGVVDVPLEEVCIGPRSLDPNGTLVHAARGLGIYV
GEIGAA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggccgagattagacgcatcggagtactcaccagcggcggcgattgcgccgggctcaac
gcggtgatccgggcggttacccaccgcgcccgccgggcctacggctggaaagtgttcggt
attctcgacggaaccatggggctgatggaccgccccttgcgctaccgcgagctcgactcg
gaaatgttttcgggcttcgacattctgcgcgccggcggcaccgttctgggtaccgtcaac
aagggcgaccccttcgccttccccatggccgacggttccaagaccgaccgctcgcttgac
ttcgtcgacggcttccacagcctggaactcgacgccctggtggtggtcggcggcgacggc
tcgatgcgcattctcaagaagctgtgcgacaagggcagcatcggcatggtcggcgtgccc
aagaccatcgacaacgatgttcacggcaccgaatacgccgtcggcttctccaccgccacc
aatgtggtgaccgaggccctggaccgtctgcaggcgaccgctgccagtcaccaccgggtg
atgatcctggaagtcatgggccgcgacgccggccatatcgccgtcagcgccggcatcgcc
ggcggcgccgatgtcatcttgatccccgagatcccctataccctggaaggcgtggccaag
cgcatccgcgaggttcagcaggaaggccgcagccacgccctgatcgtcgtcgccgagggc
gtgctgacccccgagggcgagcgcgccaccgtggcctatgccggtggccaaacccgctat
ggcggcatcagccagtatctgtccgaccgcatcgcccaggacaccggcaccgaaacccgg
gtgaccatcctcggccacgtccagcgcggcggcattccttcgatgcgcgaccgcctcctc
gcctcggccttcggcgtccatgccgtcgatctggtggcggcgcgcaaattcggccgcatg
gtggcttggcaggaccggggcgtcgtcgacgtgccgctggaagaggtctgcatcggaccg
cgcagccttgatcccaatggtaccctggtccatgccgcccgcggcctgggcatctatgtc
ggcgaaatcggcgccgcgtaa

DBGET integrated database retrieval system