KEGG   Rhodospirillum rubrum F11: F11_05395Help
Entry
F11_05395         CDS       T02006                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:rrf01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rrf01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rrf00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rrf00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rrf00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rrf00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:rrf00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1240770..1241870)
Genome map
AA seq 366 aa AA seqDB search
MAEIRRIGVLTSGGDCAGLNAVIRAVTHRARRAYGWKVFGILDGTMGLMDRPLRYRELDS
EMFSGFDILRAGGTVLGTVNKGDPFAFPMADGSKTDRSLDFVDGFHSLELDALVVVGGDG
SMRILKKLCDKGSIGMVGVPKTIDNDVHGTEYAVGFSTATNVVTEALDRLQATAASHHRV
MILEVMGRDAGHIAVSAGIAGGADVILIPEIPYTLEGVAKRIREVQQEGRSHALIVVAEG
VLTPEGERATVAYAGGQTRYGGISQYLSDRIAQDTGTETRVTILGHVQRGGIPSMRDRLL
ASAFGVHAVDLVAARKFGRMVAWQDRGVVDVPLEEVCIGPRSLDPNGTLVHAARGLGIYV
GEIGAA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggccgagattagacgcatcggagtactcaccagcggcggcgattgcgccgggctcaac
gcggtgatccgggcggttacccaccgcgcccgccgggcctacggctggaaagtgttcggt
attctcgacggaaccatggggctgatggaccgccccttgcgctaccgcgagctcgactcg
gaaatgttttcgggcttcgacattctgcgcgccggcggcaccgttctgggtaccgtcaac
aagggcgaccccttcgccttccccatggccgacggttccaagaccgaccgctcgcttgac
ttcgtcgacggcttccacagcctggaactcgacgccctggtggtggtcggcggcgacggc
tcgatgcgcattctcaagaagctgtgcgacaagggcagcatcggcatggtcggcgtgccc
aagaccatcgacaacgatgttcacggcaccgaatacgccgtcggcttctccaccgccacc
aatgtggtgaccgaggccctggaccgtctgcaggcgaccgctgccagtcaccaccgggtg
atgatcctggaagtcatgggccgcgacgccggccatatcgccgtcagcgccggcatcgcc
ggcggcgccgatgtcatcttgatccccgagatcccctataccctggaaggcgtggccaag
cgcatccgcgaggttcagcaggaaggccgcagccacgccctgatcgtcgtcgccgagggc
gtgctgacccccgagggcgagcgcgccaccgtggcctatgccggtggccaaacccgctat
ggcggcatcagccagtatctgtccgaccgcatcgcccaggacaccggcaccgaaacccgg
gtgaccatcctcggccacgtccagcgcggcggcattccttcgatgcgcgaccgcctcctc
gcctcggccttcggcgtccatgccgtcgatctggtggcggcgcgcaaattcggccgcatg
gtggcttggcaggaccggggcgtcgtcgacgtgccgctggaagaggtctgcatcggaccg
cgcagccttgatcccaatggtaccctggtccatgccgcccgcggcctgggcatctatgtc
ggcgaaatcggcgccgcgtaa

DBGET integrated database retrieval system