KEGG   Rhodospirillum rubrum F11: F11_05660Help
Entry
F11_05660         CDS       T02006                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rrf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1289667..1290857
Genome map
AA seq 396 aa AA seqDB search
MLDHTSGPGSDSPVPTIGSPALPRGFFHAEGASPAGRLYLQPVGLLDGQAAAQAVVEGLA
LPLAGRADHAFCLIAALLRGAAGDVILRCLVSPAALRQWAASEGAGIAAEVEAVLARLSA
PRPPFAGLPLGRGNALVMGILNVTPDSFSDGGDHVGFDAALAGGQAMLAAGAAILDVGGE
STRPGAAPVDPQDEIARVVPVIRAFAERGAVVSVDTRNASTMEAALAAGARIVNDVTALT
GDERALGVVARARAPVILMHIRGEPRTMQSDPSYASAPLDVVDWLAERLACCRAAGMDDG
DLCVDPGIGFGKTVDHNLEVLEATTLLHGLGVGVLIGASRKSFIGRVADVGTPKARLPGS
LAAALAAARRGADIVRVHDVGETVQALRVAAAIESA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaccacaccagcggaccggggtctgattccccggtcccgaccatcggaagcccc
gctttaccgcggggcttcttccatgcggagggggcgtcgccggccgggcggctttacctc
cagcccgtcggcctgcttgatggccaagccgccgcccaagccgtggtcgaaggcttggcc
ctgcccttggccgggcgcgccgaccacgctttttgtctgatcgccgccctgttgcgcggc
gcggccggggacgtgatcttgcgctgtctggtcagcccggcggccctgcgccaatgggcg
gcaagcgagggcgccggcatcgccgccgaggtcgaagcggtattggcccgcctgtccgcc
ccgcgtccgcccttcgccggcctgcccttgggccgggggaacgccctggtcatgggcatt
ctgaacgtcacccccgacagcttttccgatggcggcgaccatgtcggcttcgacgccgct
ttggccggggggcaggcgatgctggcggcgggggcggccatccttgatgtcggcggcgaa
agcacccgccccggcgccgctcccgtcgatccccaagacgagatcgcccgggtggttccg
gtgatccgcgccttcgccgaacgcggcgcggtggtctcggtcgatacccgcaacgcttcg
accatggaggcggcgctggccgccggggcgcgcatcgtcaatgacgtcaccgccctgacc
ggcgatgagcgggcgctgggcgtggtggcgcgcgcgcgcgctccggtgattttgatgcat
atccgcggcgagccgcgcaccatgcaaagcgatccatcctatgccagcgccccgctggac
gtggtcgactggctggccgaacggctggcgtgctgccgggccgccgggatggacgacggt
gatctgtgcgtcgatccggggatcggctttggcaagaccgtcgatcataatctggaagtg
ctggaagccacgaccttgttgcacggcctgggggttggcgttttgatcggcgccagccgc
aaaagcttcatcggccgcgtcgccgatgtcgggacgcccaaggcccgcctgcccggatcg
ttggccgccgccctggccgccgcccgccgcggcgccgatatcgtccgcgttcacgacgtg
ggcgaaaccgttcaggcgctgcgcgtcgccgcggcgatcgagagcgcctag

DBGET integrated database retrieval system