KEGG   Rhodospirillum rubrum F11: F11_06230Help
Entry
F11_06230         CDS       T02006                                 

Definition
succinate dehydrogenase subunit D
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    F11_06230
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    F11_06230
   00650 Butanoate metabolism
    F11_06230
  Energy metabolism
   00190 Oxidative phosphorylation
    F11_06230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1420403..1420789
Genome map
AA seq 128 aa AA seqDB search
MSLRSPLGRARGLGSAKAGAANHWMAERLPAIALVPLALWFVFVAIISNLGASYAQIQAF
MAVPLNATLMLLTVFCAFFHGALGLIVIIEDYVQNHAVKNALVFGTKLYALFGAVLAAVS
ILKLTFGG
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtccctacgctctccgctcggccgcgcgcgcggcctgggttccgccaaggcgggtgcc
gccaatcactggatggccgagcgccttccggccatcgccttggtgccgctggcgctgtgg
ttcgttttcgtcgccatcatcagcaatctgggggcgagctacgcccagattcaggctttc
atggcggtgccgttgaacgccaccttgatgctgctgacggtgttctgcgcctttttccac
ggcgcgctcggcctgatcgtgattattgaagattacgtccaaaatcacgccgtcaagaac
gctttggtcttcggaaccaagctctacgccttgttcggtgccgttctggccgccgtctcc
atcctcaagctgactttcgggggctaa

DBGET integrated database retrieval system