KEGG   Rhodospirillum rubrum F11: F11_06270Help
Entry
F11_06270         CDS       T02006                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    F11_06270
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    F11_06270
   00640 Propanoate metabolism
    F11_06270
   00660 C5-Branched dibasic acid metabolism
    F11_06270
Enzymes [BR:rrf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     F11_06270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1428960..1430159
Genome map
AA seq 399 aa AA seqDB search
MNIHEYQAKQVLAKYGVPVLKGGVAYTAEEAEKVALDLAGPVYVVKSQIHAGGRGKGHFK
EPSAGDKGGVRVVKSTDEVFSNAKQMLGATLVTHQSGAEGKEVKRVYIEDGCDIKRELYL
SLLVDRATSAVTVMASTEGGMDIEEVANHSPEKIFFQAIDQATGISGFHCRNVAFSLGLE
GKQVGAFTKLLSALYKCFTETDCSMLEINPLVVTGDGQVIPLDCKMNFDSNALYRHPDIV
EYRDEDEEDPMELEASKHDLNYIKLDGSIGCMVNGAGLAMATMDIIKLKGGAPANFLDVG
GGATRERVTAAFKIILSDPNVDGILVNIFGGIMRCDVIAEGVIAAAREVSLNVPLVVRLE
GTNVELGKKIMVESGLPIISADNLADAAEKVVKAVKEAS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgagtatcaggccaagcaggtcttggccaagtacggggttcccgtgctc
aagggaggcgtggcctataccgccgaggaggcggaaaaggtcgctctggacctggctggt
ccggtctacgtggtgaaatcgcagatccacgccggtggccgcggcaaaggtcacttcaag
gaaccctcggccggcgacaaaggcggcgtgcgcgtcgtcaagtcgacggacgaggtgttt
tccaacgccaagcagatgctgggcgccaccctggtcacccaccagtcgggggccgagggc
aaggaagtcaagcgcgtctatatcgaagacggctgcgacatcaagcgcgagctttatctg
tcgctgctcgtcgatcgggcgacctcggccgtgaccgtgatggcctcgaccgagggcggc
atggacatcgaggaggtcgccaaccattccccggagaagatcttcttccaggccatcgat
caggccaccgggatttccggcttccactgccgcaacgtggcgttctcgctgggtctggaa
ggcaagcaggtcggcgccttcaccaagctgctgagcgcgctttacaagtgcttcaccgaa
accgattgctcgatgctggagatcaacccgctggtggtcaccggcgacggtcaggtgatc
ccgctcgattgcaagatgaacttcgattccaacgccctctatcgtcatcccgatatcgtc
gaataccgcgatgaggacgaagaggatccgatggagctggaggcgtcgaagcacgacctc
aattacatcaagctcgatggctcgatcggctgcatggtcaacggcgccggtctggccatg
gcgaccatggacatcatcaagctcaagggcggcgcgccggccaatttccttgacgtcgga
gggggcgccacccgcgaacgcgtcaccgccgccttcaagatcatcctgtccgaccccaat
gtcgacggtatcctggtcaatatcttcggcggcatcatgcgctgcgacgtcatcgccgag
ggggtgatcgccgccgcccgcgaagtgtcgctgaacgtgccgctggtggtgcgcctggaa
ggcacgaacgtcgaactcggcaagaagatcatggtcgagtccggcctgccgatcatttcg
gcggataatttggccgacgccgccgaaaaggtggtcaaggcggtgaaggaggcttcctga

DBGET integrated database retrieval system