KEGG   Rhodospirillum rubrum F11: F11_06670Help
Entry
F11_06670         CDS       T02006                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rrf00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rrf00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rrf02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1522107..1523849
Genome map
AA seq 580 aa AA seqDB search
MRTLCATLMLTTCLGTAAQAATVYPLDRATILAGSPFDLKVEFDGAVKAADVTVTINGQP
AAKVLGKDVQFVEKEAGTEASAVLIRAATLAKPGSYTLTASAGADTKSVTWDVYGTPATA
KAKNVIFFLGDGLSVAHRTGARLMSKGMTEGKANGRLNMDDLDHMAFIGTSATNAVATDS
ANTMSAYMTGHKTAVNALGVYADRTEDSLDDPRVETIAEALRRTTTKSIGVVAMSELEDA
TPAAVFAHTRKRADKAKITEMIFDLKPDVLLGGGSAFFLPKSVPGSKRKDDKDYVAAFKD
AGYTVATSASELEAAKGTNSGKILGLFHTGNMDTYLDRVQLKKGTVGKFPDQPGLVEMTT
VALGQLAKNPDGFFLMVEGSSIDKMAHPMDWERSMVETIEFDQAIGVAREFVKTHPDTLI
VVTGDHTHGVSIIGTIDDNKPGAEMRDKVGTYADAGFPNYTDENKDGYPDRVDVSRRLAI
FSSNFPDYYETFQPKLDGPFVPAIQNEKKEYVANEAYKSVPGAVLRIGNLPRSEDTAVHA
VDDVVLQATGPGAEGFKGYMEESDVYRVLAETLALAPAKK
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcggaccctttgcgcgaccttgatgctcaccacctgcctgggcaccgccgcccaggcc
gccaccgtctatccgctcgatcgggcgacgatcctcgccggctcgcccttcgatctgaaa
gtcgagttcgacggggccgtcaaagccgccgacgtgacggtgaccatcaatggtcagccc
gccgccaaggtgttgggcaaggacgttcagttcgtcgaaaaggaagcgggcaccgaggcc
tcggccgtactgatccgcgccgccaccctggccaagccgggctcctataccctgaccgcc
agcgccggggcggacaccaaaagcgtcacctgggatgtttacggcacgccggcgacggcc
aaggccaagaacgtcatcttcttcctgggcgacggcctgtcggtggcccaccgcaccggc
gcccgcctgatgtccaagggcatgaccgagggcaaggccaacggccgcctgaacatggac
gacctcgaccatatggccttcatcggcacctcggcgaccaatgccgtcgccaccgatagc
gccaataccatgtcggcctatatgaccggccacaagacggcggtgaacgcccttggcgtc
tatgccgaccgcaccgaggacagcctggacgatccccgcgtcgagaccattgccgaggcc
ctgcgccgcaccaccacgaagtcgatcggcgtcgtggcgatgtccgagcttgaagacgcc
accccggccgccgttttcgcccatacccgcaagcgggccgataaggccaagatcaccgag
atgatcttcgatctgaaacccgacgtgctgctcggcggcggctcggccttcttcctgccc
aaaagcgtccccggttccaagcgcaaggacgacaaggactatgtcgccgcgttcaaggac
gcgggctataccgtggcgacctcggccagcgaactggaagccgccaagggcaccaatagc
ggcaagatcctgggccttttccacaccggcaatatggatacctatctcgatcgcgtgcag
ttgaagaagggcaccgtcggcaagttccccgaccagcccggtctggtcgagatgaccacc
gtcgccctgggccagcttgccaagaacccggacggcttcttcctgatggtcgaaggctcg
tcgatcgacaagatggcccatccgatggattgggaacgctcgatggtcgagaccatcgaa
ttcgatcaggcgatcggcgtcgcccgcgagttcgtcaaaacccatcccgatacgctgatc
gtcgtcaccggcgaccatacccacggcgtgtcgatcatcggcaccatcgacgataacaag
cccggtgccgagatgcgcgacaaggtcggcacctatgccgatgccggtttccccaattac
accgacgaaaacaaggacggctatcccgaccgcgtcgatgtctcgcgccgtctggcgatc
ttctcgagcaatttccccgattactacgaaaccttccagcccaagctcgatggccccttc
gttcccgccattcagaacgagaagaaggaatacgtcgccaacgaggcctataagtcggtt
cccggcgccgtgttgcgcatcggcaatctgccgcgcagcgaagacaccgccgtccatgcc
gtcgacgatgtcgttctccaggccaccggccccggcgccgagggcttcaagggctatatg
gaggaaagcgacgtctatcgcgtgctggccgaaaccctggcgctcgctccggcgaaaaag
taa

DBGET integrated database retrieval system