KEGG   Rhodospirillum rubrum F11: F11_07015Help
Entry
F11_07015         CDS       T02006                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    F11_07015 (tpiA)
   01230 Biosynthesis of amino acids
    F11_07015 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F11_07015 (tpiA)
   00051 Fructose and mannose metabolism
    F11_07015 (tpiA)
   00562 Inositol phosphate metabolism
    F11_07015 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    F11_07015 (tpiA)
Enzymes [BR:rrf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     F11_07015 (tpiA)
Exosome [BR:rrf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   F11_07015 (tpiA)
  Exosomal proteins of bladder cancer cells
   F11_07015 (tpiA)
  Exosomal proteins of melanoma cells
   F11_07015 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1599769..1600545)
Genome map
AA seq 258 aa AA seqDB search
MNARLWIGTSWKMHKTIAEAEAYVGELTASPLLDRVEAFIVPPFTALAAVHRALGDAPVH
LGAQTMHWQDEGAQTGEISPLMLRDCGVGIVELGHSERRASHGETDATVNAKVASALRHG
LRPLICVGDQGDDLDAGASIETVLRQVKLAIKGIDTASLGRALIAYEPVWAIGEAGRPAE
PAHVAEVHGALRAMLGQRGLAALPLLYGGSVDRANAGALTALANVDGLFVGRAAWTARGF
EEVIEAALHGAKDRAGLA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccgattgtggatcggaacaagctggaagatgcacaagaccatcgccgaggcc
gaggcctatgtcggcgaactgaccgcctcgccgctgctcgaccgggtcgaggcgttcatc
gtgccgcccttcaccgccctggccgccgtccaccgggctttgggcgacgccccggtccac
ctgggcgcccagaccatgcattggcaagacgagggggcgcagaccggcgagatttccccg
ctgatgctgcgcgattgcggcgtcggtatcgtcgaactcggccattccgagcgccgcgcc
agccatggggaaaccgacgccaccgtcaacgccaaggtggccagcgccctgcgccacggt
ttgcggccgctgatctgcgttggcgaccagggcgacgacctggacgccggagcctcgatc
gaaacggtcctgcgccaagtcaagctggccatcaaaggcatcgacacggccagcctgggc
cgggcgctcatcgcctatgaaccggtctgggcgatcggcgaagccgggcgaccggccgaa
ccggcgcatgtggccgaggttcatggcgccctgcgcgccatgctcggccaacggggcttg
gctgccctgcccctgctttatggcggcagcgtcgatcgcgccaatgccggggctctcacc
gccctagccaacgttgacggcctgttcgtcggccgcgccgcctggacggcgcgcggcttc
gaagaggtgatcgaggccgctttgcacggggccaaggaccgggcgggtcttgcgtaa

DBGET integrated database retrieval system