KEGG   Rhodospirillum rubrum F11: F11_07015Help
Entry
F11_07015         CDS       T02006                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K21910  
L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
rrf  Rhodospirillum rubrum F11
Brite
Enzymes [BR:rrf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     F11_07015 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1599769..1600545)
Genome map
AA seq 258 aa AA seqDB search
MNARLWIGTSWKMHKTIAEAEAYVGELTASPLLDRVEAFIVPPFTALAAVHRALGDAPVH
LGAQTMHWQDEGAQTGEISPLMLRDCGVGIVELGHSERRASHGETDATVNAKVASALRHG
LRPLICVGDQGDDLDAGASIETVLRQVKLAIKGIDTASLGRALIAYEPVWAIGEAGRPAE
PAHVAEVHGALRAMLGQRGLAALPLLYGGSVDRANAGALTALANVDGLFVGRAAWTARGF
EEVIEAALHGAKDRAGLA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccgattgtggatcggaacaagctggaagatgcacaagaccatcgccgaggcc
gaggcctatgtcggcgaactgaccgcctcgccgctgctcgaccgggtcgaggcgttcatc
gtgccgcccttcaccgccctggccgccgtccaccgggctttgggcgacgccccggtccac
ctgggcgcccagaccatgcattggcaagacgagggggcgcagaccggcgagatttccccg
ctgatgctgcgcgattgcggcgtcggtatcgtcgaactcggccattccgagcgccgcgcc
agccatggggaaaccgacgccaccgtcaacgccaaggtggccagcgccctgcgccacggt
ttgcggccgctgatctgcgttggcgaccagggcgacgacctggacgccggagcctcgatc
gaaacggtcctgcgccaagtcaagctggccatcaaaggcatcgacacggccagcctgggc
cgggcgctcatcgcctatgaaccggtctgggcgatcggcgaagccgggcgaccggccgaa
ccggcgcatgtggccgaggttcatggcgccctgcgcgccatgctcggccaacggggcttg
gctgccctgcccctgctttatggcggcagcgtcgatcgcgccaatgccggggctctcacc
gccctagccaacgttgacggcctgttcgtcggccgcgccgcctggacggcgcgcggcttc
gaagaggtgatcgaggccgctttgcacggggccaaggaccgggcgggtcttgcgtaa

DBGET integrated database retrieval system