KEGG   Rhodospirillum rubrum F11: F11_07745Help
Entry
F11_07745         CDS       T02006                                 

Definition
signal transduction histidine kinase with CheB and CheR activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    F11_07745
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    F11_07745
Enzymes [BR:rrf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     F11_07745
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     F11_07745
Two-component system [BR:rrf02022]
 CheA family
  CheA-CheYBV
   F11_07745
Bacterial motility proteins [BR:rrf02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    F11_07745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1771207..1775490
Genome map
AA seq 1427 aa AA seqDB search
MLAALPDRPGIALILVQHLDPTHESMMVALLALQTTMTVCQAAEGMIVEPDHLYVIPPGA
YLSVAGGTLHLSPPQARHGARLPFDFLLHSLAADYTQRAICVVLSGTGADGSLGLMALKE
RGGLVIAQDPEEAGYDGMPRSAIATGQVDLVLSLAKIAETLVGEDLPPGKPALPEEIPSS
KGKGKGKGWVYAVIDLLRARTPYDFTHYKPGTLERRTERRMTLASIEVGDSARYLALLQE
DATERDLLAKDLLINVTGFFRDPKVFDVLAEKTIPQMVATHPLDQPLRIWVAGCSTGEET
YSLAILFREAIVSAGRAVKVQVFASDVDPDAVLSAREGRYPSTIEADVSAERLARFFTRD
GDDYRILPDLRSMVVFTVQDLLADPPFSRLDMVSCRNLLIYLRPEAQAKAIGLFHFALRE
GGILLLGNSETAGNVEGRFEVLSKSARLYRRIGRGGRVDLRLPVVGGDGSGAQRRPLFEP
ARSRQATLADLCRRLVVEAYAPAAVLITLKYDCLYFLGAMDSYLRVAAGHPASDLLSLAR
EEVRTKLRSAIEMACETKTRTLVTGGRLTHGGTVRGFSIAVHPVSHDGEDLLLVCFLDEV
PSERRADTPTSAEHAPRVAELEQELEITRSELRGAIRNLEISSEEQKAINEEALSVSEEY
QATNEELLASKEELQSLNEELTALNGQLHETLERQRTTSNDLQNVLYSTDVATLFLDTAL
NIRFFTPATKLLFRVIPGDIGRPLADLSPLVADDALLGDAAKVLKTMTPIEREIEARSGS
WYLRRILPYRTQDNGVEGVVITFADITERRWAADAREVAKRQAQIANMAKSRFLAVASHD
LRQPLQTLTLLQGLLAKKVEGVQSRVLLARMDETLGAMSSMLNVLLDINQIEVGTVEAER
VVFPINDLFDRVREELAYQARAKKLDWSVVSCGLSVTSDPRLLEQMIRNLLANALKYTKQ
GKVLLGCRRRSGSLSIEVWDSGIGIPPGELEAIFDEFHQVETPAQGQGRGLGLGLSIVRR
LGDLLGHPIGVRSRLGKGSVFTINVAIAPAAAEKPSLPARRGAAEVKVDADGQRTGEILI
IEDDPDVRDLLDLLLKGEGHRTVAVAEGGQAVALAEGGSIRPDLILADYNLPNGVNGLGV
SATLRDVLDRPIPVVILTGDISTRTLHDIARHRCVKLNKPVKPGELTQTIARLLPPPVGP
AAARLPAPPPSPGPGGPLPLIYLVDDDASLRDSLRALLEDDGLKVEDYESSEAFLAAYRP
GGGEACLLIDAYLPGMSGLDLLERLKKENRLLPAIVITGYSEVAMAVQAMKAGASDFIEK
PVGRTELLISIDRALEQHREHGNSGKMRLWRDAAKARLASLSARQREIMEMVLAGQPSKN
IAADLGISQRTVESHRALIMKKLGVKSLPALVRLAQAASDGEVGEEG
NT seq 4284 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgcggccttgcccgatcgtcccggcatcgccctgatcctggtccaacatcttgat
cccacccatgaaagcatgatggtggccttgctcgccctgcaaaccaccatgacggtttgc
caggcggccgaaggcatgatcgttgagcccgatcacctttatgtcatcccgcccggcgcc
tatctttccgttgccgggggaaccctgcacctctcgccaccccaggcccgccatggcgcc
cgcctgccgttcgatttcctgctgcattcgctggctgcggattatacgcagagggctatc
tgcgtggttctttcgggaaccggggcggatggcagtctgggattgatggcgttgaaagag
cgcggcgggctggtgatcgcccaggatcccgaagaggccgggtatgatggcatgccgcgc
agcgccatcgccaccggacaggtcgatctggtgctgagcctcgccaagatcgccgaaacc
ctggtcggcgaggacctgccccccggtaagcccgcccttcccgaggagatcccgtcgagc
aagggcaaaggcaaaggcaaaggctgggtttacgcggtgatcgatctgctgcgcgcccga
accccctatgacttcacccattacaagccgggcaccctggaacggcggaccgaacggcgc
atgacgttggcctcgatcgaggtcggcgactcggcgcgctatttggcgcttctccaggag
gatgccaccgagcgcgatcttcttgccaaggacctgctgatcaacgtcaccggttttttc
cgcgatcccaaggtcttcgatgtcctggccgaaaagaccattccccagatggtcgccacc
catccccttgatcagcccctgcgcatttgggtcgcgggctgtagcacgggcgaggaaacc
tattccctggccatactgttccgcgaggcgatcgtcagcgccgggcgggcggtcaaggtg
caggtcttcgcctccgatgtcgatcccgacgccgtcctcagcgcccgcgaaggccgttat
cccagcaccatcgaagccgatgtctcggccgaacggctcgcccgcttcttcaccagggac
ggcgatgattaccgtattctgcccgacctgcgctccatggtggttttcaccgttcaggat
ttgctggccgatccgccgttttcgcggctggatatggtgtcgtgccgcaatctgctgatc
tatctgcgccccgaagcccaggccaaggcgatcggcctgttccatttcgccctgcgcgag
ggcggcattctgttgctgggcaattccgagacggcgggcaatgtcgaaggccgcttcgag
gttttgtccaaatcggcgcggctctatcggcggatcggtcgcggcggccgggtcgatttg
cgtttgccggtggtcgggggcgatgggagcggggcccagcgccggcccctgttcgagccg
gcgcggtcgcgtcaggccacccttgccgatctctgccggcggcttgtcgtcgaggcctac
gccccggcggcggtgttgatcaccctgaaatacgactgtctttatttcctgggggcgatg
gacagctatctgcgggtggcggcgggccatccggcctccgatctgctcagtctggcccgc
gaggaggtgcggaccaagctgcgctcggccatcgagatggcgtgcgaaacgaaaacacga
accctggtcaccggcggccggcttacccatggcggcaccgtgcggggcttcagcatcgcc
gttcatcccgtctcccacgatggggaagacctgctgctggtctgtttccttgacgaagtg
ccgtccgaacgacgggccgatacgccgacttcggccgagcacgcgccgcgggtggccgaa
ctggagcaagagcttgaaatcacgcgaagcgaactgaggggcgccattcgcaatcttgag
atttcaagcgaagaacaaaaggcgatcaacgaagaggccttgtcggtcagcgaggaatat
caggcgacgaacgaggaactgctggcctccaaagaggaattgcagtcgctgaacgaggaa
ctgaccgcgctgaacggccagcttcatgaaacgctcgaacgccaaagaacaacctccaac
gatctgcagaacgttctctacagtacggatgtcgcgacgctttttctcgataccgcgctg
aatatccgctttttcaccccggcgacgaagctgctgttcagggtgatccccggcgatatc
ggccgaccgctggccgatctcagtcctttggtcgccgacgacgccctgctgggcgatgcc
gccaaggtgctgaaaaccatgacgccgatcgagcgcgagatcgaggcgcgcagcgggtcg
tggtatcttcgccggatcctgccctatcgcacccaggacaacggggtcgagggggtggtc
atcacctttgccgatatcaccgaacgccgctgggcggccgatgcccgcgaggtggccaaa
cgccaagcccagatcgccaatatggcgaaatcgcgctttctggcggtggcgagccatgac
ctgcgtcaaccgctccaaaccctgaccctgctccaggggcttctggccaagaaggtcgaa
ggggtgcagtcgcgcgttctgctcgcccgcatggacgagaccctgggcgccatgtcgtcg
atgctcaatgtcctgctcgatatcaaccagatcgaggttggaaccgtcgaggccgagagg
gtggttttccccatcaatgatctgttcgatcgggtgagggaggaactggcctatcaggcc
cgagccaagaagcttgactggagcgtggtttcttgcggcttgtcggtgaccagcgatccg
cgtctgcttgaacagatgatccgcaatctgctcgctaatgccctgaaatacaccaaacag
ggcaaagttcttttgggctgtcgccggcggtcgggctctttgagcatcgaggtctgggat
agcggcatcggtattcccccaggcgagctcgaggcgattttcgacgagtttcatcaggtc
gagaccccggcgcaaggacaagggcgcggcctgggccttggcctgtcgatcgtgcgccgc
cttggcgatctgcttggccatcccatcggcgtgcgctcgcggcttggcaagggctcggtc
ttcaccatcaatgtggcgatcgccccggccgccgccgagaagccttcgcttccggcgcga
cggggcgcggccgaggtcaaagtcgacgccgacggtcagcggaccggggaaatcctgatc
atcgaggacgatcccgacgttcgcgatcttcttgatcttctgctcaagggcgaggggcac
cggacggtcgccgtggccgagggggggcaggcggtggccctggccgaaggcggcagcatc
cggcccgatctgatcctggccgattataatctgccaaacggcgtcaatggcctgggcgtc
agcgccaccctgcgcgacgttctcgatcggcccattcccgtggtcatcctgaccggtgac
atttcgacccgaaccctgcacgatatcgcccgtcatcgctgcgtgaagctcaataaaccg
gtgaaacccggggaactgacccagaccatcgcccgcctgctgcccccgccggtggggccg
gcggcggcgcggctgccagccccgccgccgtcgccaggccccggtggtccgttgcccttg
atctatctggtcgacgatgacgcgtctttgcgcgacagcctgcgcgccctgctggaagac
gacggcctgaaagtggaagactacgaaagctccgaagccttccttgccgcctatcgcccg
ggcggcggcgaagcctgcctgctgatcgatgcctatcttcccggaatgagcgggcttgac
ctgcttgaacggcttaaaaaagaaaaccgccttttgcccgcgatcgtcatcaccggctat
agcgaggtggcgatggcggtgcaggcgatgaaggcgggcgcttcggatttcatcgaaaag
ccggtcggtcgaaccgaattgttgatcagcatcgaccgcgccctggaacagcatcgcgag
catggcaacagcggcaagatgcggctttggcgcgatgccgccaaagcccgcctcgccagt
ctgagcgcgcgccagcgcgaaatcatggagatggtccttgccgggcaaccgagcaagaac
atcgccgccgatctggggatcagccaaagaaccgtggaaagccatcgcgccctgatcatg
aagaaacttggcgtgaaatccctgccggccttggtccgtctggcccaggccgccagcgac
ggtgaggtcggcgaagaggggtaa

DBGET integrated database retrieval system