KEGG   Rhodospirillum rubrum F11: F11_07985Help
Entry
F11_07985         CDS       T02006                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    F11_07985
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    F11_07985
Enzymes [BR:rrf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     F11_07985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1824299..1825738
Genome map
AA seq 479 aa AA seqDB search
MMTDPLSANPGFFLRLSALWRDIAGGRGTGAMPPLSPGLDDDDMGVVRQQLNACLEGKGG
VVSAHARAASLGRAYLSLNEEGRIRFLGILAREFSTDHQAVIAAARALIEASSGGDTGAI
LAAETELGRTLTAPRRILLTQFNALPEGVKFLVDLRGELLTHIKTHPELRPLERDLRDLL
TAWFDVGFLDLERITWESSASFLEKIITYEAVHAIQSWDDLKNRLDHDRRLYAFVHPRMP
HEPLIFVEVALVNGISGTIGDLLDLEAPLLDPAQADTAIFYSISNAQSGLAGISFGNFLI
KRVVETLRREFPGLKTFSTLSPIPGFRRWLDGVFAEGDIGPMSSAERKALRAVDDRGAKG
ALKRLIETDGWLTEEGGEEAVKGPLMRLCARYLAVERRLGSGEGVERAYDPVAHFHLTNG
ARVERINWRGDLSANGLRQSMGMMVNYLYKLDEIEKNHEAYQGNAVAAVSGTVKTLLKA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgatccgctttccgccaatccggggttcttcctgcggctttccgccctgtgg
cgcgacatcgccggcggtcgtggcacgggggcgatgccgccgctgtcaccggggttggac
gacgatgacatgggcgttgtccgccaacagttgaacgcctgcctggagggcaagggcggc
gtggtgtccgcccatgcccgcgccgcctcgctggggcgggcctatctcagcttgaacgag
gaggggcgcatccgctttcttggcattctcgcccgcgagttctcgaccgaccatcaggcg
gtgatcgccgccgcccgcgccctgatcgaggcctcgtcgggcggcgacacgggcgccatc
ctggcggccgagaccgagctggggcggacgctgacggcgcccaggcgcattcttctcacc
cagttcaacgccttgcccgaaggggtgaagtttctggtcgatttgcgcggcgaactgctg
acccacatcaaaacccatcccgaactgcggccgctggaacgggatttgcgcgatctgctg
accgcttggttcgatgtcggcttccttgatctggaacgcatcacctgggagtcgtcggcc
tccttcctggaaaagatcatcacctatgaggccgtccacgccatccaaagctgggacgac
ctgaaaaaccgccttgatcatgaccgccggctttacgccttcgtccatccgcgaatgccc
cacgagccgctgatcttcgtcgaggtcgccctggtcaacggcatctcgggcaccatcggc
gatctgcttgatcttgaagcgccgctgcttgatccggcccaggccgacaccgcgatcttt
tattcgatctccaacgcccaaagcggtctggcggggatcagttttggcaatttcctgatc
aagcgggtggttgaaaccctgcgccgtgaatttcccggcctcaagaccttctcgaccctg
tcgccgatccccggcttccgccgctggctcgacggggtcttcgccgagggggatatcgga
ccgatgtcgagcgccgagcgcaaggccctgcgcgccgtcgatgatcgcggcgccaagggg
gcgctcaaacgcctgatcgaaaccgacggttggttgaccgaagagggcggggaagaggcg
gtgaagggccccctgatgcgcctgtgcgcgcgctatctggcggtcgagcgccgcctgggc
agtggcgagggcgttgagcgggcctatgatccggtcgcccatttccatctgaccaacggg
gcgcgcgtcgagcgcatcaattggcgcggcgatttgtcggccaacggcctgcgccagtcg
atgggcatgatggtgaactatctctataagctcgacgagatcgagaagaatcacgaagcc
tatcagggcaatgccgtcgccgcggtcagcggcacggtgaagactctgctcaaggcctag

DBGET integrated database retrieval system