KEGG   Rhodospirillum rubrum F11: F11_08290Help
Entry
F11_08290         CDS       T02006                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    F11_08290
Enzymes [BR:rrf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     F11_08290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1898982..1901081
Genome map
AA seq 699 aa AA seqDB search
MVAPDAALKAALAALGWPAEDEAQAARSLAALEAAPWAEALPPCVIHRLGDTPAVLTVPV
VTTGDSFGPGRWSLTPEEGAQALPATGTFDPQSLTVEESGPEGKTRRRLDLGLDLPMGYH
RLRVEGLAPTALETVLIVAPRRCWLPEGWEDREGPRLWGVATQVHGLRSLNDWGMGDFDS
LAVLARLTGRQGGDLLGVSPLHALFPARPLHASPYSPNSRLFLNPLYISIPSVPEYDLSP
ELAAFTNDLGALQQPELIDLAAVAEGKWSALAILHRRFVAQHLGRRTPRGQAFTAFLKEG
GEHLEKFAIFQTLSEHFKERGWSWRDWPAEFHDPAAPAVAAFAGEQAARVLFHQWCQFEA
DRQLALVAKAAADAGQRVGLYRDLALGSDPTGADCWALRGVMAEGLSVGAPPDPWNAKGQ
NWGFPPFHPGHLRQAAYQPFARMIRANMREAGALRMDHVLGLMRLFCIPWGMEGREGFYL
RMPFEDLLAVLALESHRARCIVVGEDLGTVPDGFRDRMREAAVLSYRLFFFERGHDQALT
PPEAYPRLATVAASTHDLPTLAGFWAGRDLAWKNDLDLFPSEQARNAESMDRHNDRPRIR
ATLAAAGTPLSDPGTFTPPPELVPAVTAWLARTPSLILMLQIEDVLEMPEQANMPGTIDQ
HPNWRRRIPLAVEALEVDGRLGRLACILASHGRGAAAKR
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcccccgacgcggcgctgaaggcggctttggcggctttgggctggccggcggag
gacgaggcgcaggcggcgcggtcgctggccgcccttgaggccgccccctgggccgaggcg
ctgccgccttgcgtcatccatcgcctgggtgacacgcccgccgtcctgacggtgccggtg
gtgacgacgggcgactcgtttggccccggccgctggagtctgacccccgaggagggagcg
caagccctaccggcgaccgggaccttcgatccacaaagcctgacggtcgaggagtcgggg
ccggagggtaagacacggcgccgccttgacctcggcctcgatctgccgatggggtatcat
cgcctgcgcgtcgagggacttgccccgacggcgctggagaccgtgctgatcgtcgcgccc
aggcgctgttggctgcccgagggctgggaagaccgcgaggggccgcgtttgtggggcgtg
gcgacccaggttcatggcctgcgcagtctcaacgactggggaatgggcgatttcgactcg
ttggccgtgctggcgcggctgaccggccgccagggcggtgatctgttgggcgtcagcccg
cttcacgcgctgtttccggcccgcccgcttcatgccagcccctattcgcccaactcccgg
ctgttcctcaatccgctctatatctcgatccccagcgttccggaatacgacctcagcccc
gagcttgccgccttcaccaacgatctcggcgcccttcagcagcccgaactgatcgatctc
gcggcggtcgccgagggcaaatggtcggctttggccattcttcaccggcgttttgtcgcc
cagcacctcggacggcggacgccgcgcggccaagcctttaccgccttcctgaaagagggc
ggggagcaccttgaaaaatttgccattttccagaccctgtccgagcacttcaaggagagg
gggtggtcgtggcgcgactggccggctgagtttcacgatccggcggcgccggcggtggcc
gcgttcgccggcgagcaggcggcccgggtgctgttccatcaatggtgccagttcgaggcc
gatcgccaattggcgctggtggccaaggctgcggccgatgccggtcagcgcgtcgggctg
taccgcgacctcgccctggggtccgatcccaccggcgccgattgctgggccctgcgcggg
gtcatggccgaggggttgtcggtgggcgccccccccgatccgtggaacgccaagggccag
aactggggattcccgccctttcaccccggccacctgcgccaagccgcctatcagcccttc
gcccggatgatccgcgccaatatgcgcgaggccggggccctgcgcatggatcatgtgctg
gggctgatgcggctgttttgcattccctgggggatggagggccgcgagggcttctatctg
aggatgcccttcgaggatcttctggccgttctcgccctggaaagccaccgggcgcgctgc
atcgtcgttggcgaagatctgggcaccgtgcccgacggcttccgcgatcgcatgcgcgag
gcggcggtgctgtcttatcggttgttcttctttgaacggggccacgatcaggcgctgacc
cccccggaagcctatccccgcttggccaccgtcgccgcgtcgacccatgatctgccgacc
ctggccgggttctgggccgggcgcgatctggcgtggaaaaacgacctcgatctgtttccc
tccgagcaggcgcgcaacgccgaaagcatggatcgccacaacgatcggccgcgaatccgc
gcgactctggcggcggcgggaacgccgctgtctgaccccgggaccttcacgccccccccc
gaactggtgccggcggtgacggcgtggctggcccgcacccccagccttattctcatgctt
caaattgaagacgtgctggaaatgcccgaacaggccaatatgccgggaaccatcgatcag
catcccaactggcgccgacgaattccgctggcggtggaggctttggaggtggacggaagg
ctgggccgtctggcatgtatcctggcgtcccacggacggggggcggcagcaaaaaggtaa

DBGET integrated database retrieval system