KEGG   Rhodospirillum rubrum F11: F11_09205Help
Entry
F11_09205         CDS       T02006                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
rrf  Rhodospirillum rubrum F11
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2080153..2081199
Genome map
AA seq 348 aa AA seqDB search
MQRLLRITAACALTLAVAGPAFAADDLRAKAKEVFEVIPTSVPEIKGNAITPARIELGRK
LFFDPRLSRSGLISCNTCHNLGMGGDDNLETSIGHGWQKGPRNAPTVLNAVFNIAQFWDG
RAEDLRTQAKGPVQAGVEMASTPERVVATLKSMPEYVADFKAAFRDDPDPVSFDNMAKAI
EIYEATLITPDSKFDKWLAGDDASMTKLETAGLSLFLDKGCAACHNGVNIGGNGYYPFGV
VEQPGADILPVADKGRFAVTKTATEEYVFRAGPLRNIALTAPYFHSGKVWDLEQAVAVMG
SSQLGETLSESDVKAITAFLTTLTGVMPKVEYPILPVSTRETPKPEGM
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtcttttaaggatcacggcggcttgcgccctgaccctcgccgtggccggcccg
gccttcgccgccgatgatctgcgggccaaggccaaagaggtcttcgaggtcatcccgacg
tcggttcccgaaatcaaggggaacgccatcaccccggcccgcatcgagcttggccgcaag
cttttcttcgatccgcgcctgtcgcgcagcggcctcatctcctgcaacacctgccacaac
ctgggcatgggcggggatgacaatcttgaaacctcgatcggccacggctggcaaaaggga
ccgcgcaacgcgccgaccgttctgaacgccgtgttcaacatcgcccagttctgggacggc
cgcgccgaagacctgcgcacccaggccaagggccccgtgcaggccggcgtcgagatggcc
agcacgcccgaacgcgtcgtcgccaccttgaagtcgatgcccgaatacgtcgccgacttc
aaagcggccttccgcgacgatcccgatccggtcagcttcgacaacatggccaaggcgatc
gagatctacgaagccacgctgatcacccccgacagcaagttcgacaaatggctcgccggc
gacgacgccagcatgaccaagctggaaaccgccgggctgtcgctgttcctcgataagggc
tgcgcggcctgtcacaacggcgtcaacattggcggcaacggctattatccgttcggcgtg
gtcgaacagccgggcgccgatatcctgcccgtcgccgacaagggccgcttcgccgtgacc
aagacggccaccgaggaatatgtcttccgcgccggccccttgcgcaacatcgccctcacc
gccccctacttccattcgggcaaggtgtgggatctcgagcaggcggtggcggtgatggga
tcgtcccagcttggcgaaaccctgagcgagtccgacgtgaaggcgatcaccgccttcctg
accaccctcaccggcgtcatgcccaaggtggagtatccgatcctgcccgtcagcacccgc
gaaacgcccaagcccgaaggcatgtaa

DBGET integrated database retrieval system