KEGG   Rhodospirillum rubrum F11: F11_09255Help
Entry
F11_09255         CDS       T02006                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rrf  Rhodospirillum rubrum F11
Brite
Enzymes [BR:rrf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     F11_09255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 RrnaAD MTS Methyltransf_18 Methyltransf_23 Methyltransf_24 Methyltransf_11 Methyltransf_12 PrmA Methyltr_RsmB-F Methyltransf_32 Methyltransf_4 CMAS
Motif
Other DBs
NCBI-ProteinID: AEO48317
Position
complement(2093327..2093977)
Genome map
AA seq 216 aa AA seqDB search
MDYGVARTNMIENQIRTNRVTDPLVIEAMAAVPREIFVPKAFRGVAYVDEDLAIGGGRFL
LEPLNTARLLQVAAIKTSDVVLDIGCASGYSSAVLARMASTVVALECDGELAAKAMANLA
ELGLDNAVVVSGPLRDGYAKQAPYDVIVINGAIPAVPAALKHQLADGGRLVAVVHEKGSG
RVSVTERHGDVFGHRIAFDGNSPLLKDFEETPAFVF
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggactacggcgtcgcacgcacgaacatgatcgagaaccagatacgaaccaaccgggtc
accgatccgctggtcatcgaggcgatggcggcggtgccgcgggagatcttcgttcccaag
gcctttcgcggcgtcgcctatgtcgacgaggatctggcgatcgggggagggcgcttcctg
ctcgaaccccttaataccgcaaggctgctccaggtggcggcgatcaagacatccgacgtg
gttctcgatatcggctgcgccagcgggtattcgtcggccgtgctcgcccgcatggccagc
accgtcgtcgccctggaatgcgacggcgaattggcggccaaggcgatggccaatctcgcc
gagctggggctcgacaacgccgtggtggtcagcggaccgctgcgggacggctatgccaag
caggccccttacgacgtcatcgtcatcaatggcgcgattccggccgttcccgcggcgctg
aagcatcagcttgccgatggcggtcggctggtggcggtggtccatgaaaagggttcgggc
cgggtgagcgtcaccgagcgtcatggcgatgtctttggccatcgcatcgcctttgatgga
aactcgcctttgctcaaggatttcgaagaaacccccgccttcgttttctga

DBGET integrated database retrieval system