KEGG   Rhodospirillum rubrum F11: F11_09420Help
Entry
F11_09420         CDS       T02006                                 

Definition
GTP cyclohydrolase
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    F11_09420
Enzymes [BR:rrf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     F11_09420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2129033..2129665)
Genome map
AA seq 210 aa AA seqDB search
MEKTLLSRAQSGVEAFDATPYYKPVSVGEAEAAIAVLLRYIGEDPTREGLVETPARFIRA
CGHHFAGYAQDPLRILATTFSESAGYAGMILLRDIRFEAFCEHHLAPIIGKAHVAYMPND
RVVGLSKLARVVDVFAKRLQLQERMTMQIATAIEAALAPRGVAVLIESEHHCMSTRGAYK
PGSTMVTSVTTGCFEADGAPRREFFEAVRA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaccttgctgtcgcgtgcgcaaagcggtgtggaagcctttgatgcgacgccg
tattacaagcccgtctcggtcggagaggccgaggcggccatcgccgtgcttctgcgctat
atcggcgaggatccgacgcgcgagggattggttgaaaccccggcccgcttcattcgcgcc
tgcggccatcatttcgccggctatgcccaagatcccctgcgcatcctcgccaccaccttt
tccgaaagcgccggctacgccgggatgatcctgctgcgcgacatccgctttgaggccttt
tgcgagcaccatttggccccgatcatcggcaaggcccatgtcgcctatatgccgaacgac
cgcgtggtcgggctgtcgaagctcgcccgggttgtcgatgtcttcgccaagcgcctgcaa
ctgcaagagcgcatgaccatgcagatcgccacggcgatcgaggccgccctggcgccgcgc
ggggtggcggtgctgatcgagtccgagcatcactgcatgagcacgcgcggcgcctataag
ccgggatcgaccatggtgacctcggtgacgaccggttgcttcgaagccgacggcgcgccg
cgacgggagtttttcgaggccgttcgcgcctga

DBGET integrated database retrieval system