KEGG   Rhodospirillum rubrum F11: F11_09550Help
Entry
F11_09550         CDS       T02006                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    F11_09550
Enzymes [BR:rrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     F11_09550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2156810..2157295)
Genome map
AA seq 161 aa AA seqDB search
MIYIALGANLAGPAGSPRDTLDAALVALEDAGVVVAARSAWYRTSPVPPSDQPDYVNGVA
RLVTDLDPVALLGLLHRLEDQFGRRRGEINAARTLDLDLLDYDELRRTGAPPLLPHPRMA
ERGFVLFPLREIAPDWRHPVLDQPIDTLIAALAADQAAERL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgatctatatcgctctcggcgccaatctggccggtccggccggctcgcccagggataca
cttgacgcggcgttggtcgcccttgaggacgccggagtggtggtcgccgcccgctccgcc
tggtatcggacgagcccggttccaccgtccgatcagcccgattacgtgaacggcgtggcc
cgtctggtcaccgacctcgaccccgtcgccctgctcgggctgcttcatcgccttgaggat
caattcgggcgtcggcgcggcgagatcaatgccgcccgcacccttgatctcgatttgctt
gattatgacgagctgcgccggaccggggcgccgccgctgctgccccatccgcgcatggcc
gagcgcggtttcgttttattccccttgcgcgagatcgcgcccgactggcgccacccggtt
cttgaccaaccgatcgacaccctgatcgccgcccttgccgccgatcaggcggcggaacgt
ttgtaa

DBGET integrated database retrieval system