KEGG   Rhodospirillum rubrum F11: F11_09655Help
Entry
F11_09655         CDS       T02006                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    F11_09655
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F11_09655
   00020 Citrate cycle (TCA cycle)
    F11_09655
   00620 Pyruvate metabolism
    F11_09655
Enzymes [BR:rrf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     F11_09655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2176545..2177867)
Genome map
AA seq 440 aa AA seqDB search
MPIEILMPALSPTMEEGTLAKWLKKEGDPIAAGDVIAEIETDKATMEFEATDEGVLGKIL
VADGTAGIKVNQPIGILLEEGEDASALVQAAPAKAPDAPAKAAPEPAPVAAASQSDAAPA
PAAAAPKRAAGERLFASPLARRIAAAEGLDLGALQGSGPHGRIVRRDVEAALAAGTGKTA
EKAVAAPVAPAAPPQAVAAAAPKPVALPDAPHTKVANTSMRKIIARRLTESKQTVPHFYL
TVDCKIDALLDLRKSLNARAEKRGDGVKLSVNDLIIKAVALALRKVPAANASWSDEAIVL
WSDVDISVAVATPGGLITPIVRKADQKGLATISAEMKDLATRARDGKLKPEEFQGGGFSI
SNLGMYGIREFAAIINPPQGCILAVGAGEQRPVVEAGALAIATVMSCTLSVDHRVVDGAV
GAEFLSAFKILIEDPMAMML
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcgagatcctgatgcccgcgctctctccaacgatggaggagggaaccctggcc
aagtggctgaagaaggagggcgatcccatcgccgccggcgatgtcatcgccgaaatcgaa
accgataaggcgacgatggaattcgaagccaccgacgagggcgttcttggcaagatcctg
gtcgccgacggcaccgccggcatcaaggtcaaccagccgatcggcattttgcttgaggaa
ggcgaggacgccagcgccctggtccaggccgctccggccaaagccccggatgccccggcc
aaggccgcgcccgagccggcccctgtcgccgcggcgtcccaaagcgacgccgcgcccgcc
ccggcggcggccgcgcccaagcgggcggccggtgaacggctgttcgccagtccgctggcc
cggcgcatcgccgccgccgaaggccttgatctgggagcccttcaaggcagcggcccccat
ggccgcatcgtgcgccgcgatgtcgaggcggctttggccgccggcaccggtaaaacggcc
gaaaaggcggttgccgcgccggtcgctcccgccgctccgccgcaagcggtcgccgccgcc
gcgcccaagcccgtggccttgcccgacgcgccccataccaaggtggccaatacgtcgatg
cgcaagatcatcgcccggcgcctgaccgagtccaagcagacggttccccatttctacctg
accgtcgattgcaagatcgacgccctgcttgatctgcgtaagagcttgaacgcccgggcc
gaaaagcgcggcgacggggtcaagctgtcggtcaacgacctgatcatcaaggccgtcgcc
ctcgccctgcgcaaggtgcccgccgccaacgcctcgtggagcgacgaggcgatcgtgctg
tggagcgatgtcgatatctcggttgccgtcgccaccccgggcgggttgatcaccccgatc
gtccgcaaggccgaccagaaggggctggcgacgatctcggccgagatgaaggatctggcg
acgcgggcccgcgacggcaagctcaagcccgaggagttccagggcggcggcttcagcatc
tccaaccttggcatgtacggcatccgcgagttcgccgcgatcatcaatccgccccagggc
tgcatcctggccgtcggcgccggcgaacaacgcccggtggtcgaggccggagccttggcg
atcgccacggtgatgagttgcacgctctcggttgaccatcgggtggtcgatggcgcggtc
ggcgccgaattccttagcgccttcaagatcttgatcgaagatcccatggcgatgatgctc
tag

  All links  
No link information was found.   
DBGET integrated database retrieval system