KEGG   Rhodospirillum rubrum F11: F11_09710Help
Entry
F11_09710         CDS       T02006                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    F11_09710
   01230 Biosynthesis of amino acids
    F11_09710
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F11_09710
   00051 Fructose and mannose metabolism
    F11_09710
   00562 Inositol phosphate metabolism
    F11_09710
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    F11_09710
Enzymes [BR:rrf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     F11_09710
Exosome [BR:rrf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   F11_09710
  Exosomal proteins of bladder cancer cells
   F11_09710
  Exosomal proteins of melanoma cells
   F11_09710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2188255..2189013)
Genome map
AA seq 252 aa AA seqDB search
MTVRRPLIAGNWKMNGLKAEGQGLARDLAQRLNKAGGVDFDLLLCPPFPLISTVVGAVAG
SGIAVGGQDCHAKAKGAHTGDVSAPMLADLGCQFVIVGHSERRADHGETDALVKAKAEAA
LAAGLIAVICVGETEAQRDAGETLAVVSGQLAGSLPTHADSGKVVIAYEPVWAIGTGRVP
TTEDVAKVHGALRKDLVGALGADGNGVRLLYGGSVKPDNAAELMALENVDGALVGGASLK
AEDFWAIAQSCA
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgcgtcgtccgcttattgccggaaactggaagatgaacggcctcaaggccgag
ggccagggcctcgcccgggatcttgcccagaggcttaacaaggccggtggggtcgatttc
gaccttcttctttgtccgccttttccgttgatcagcacggtggtcggcgccgtggccgga
tcgggcatcgccgttggcggccaggattgccatgccaaggccaagggcgcccatacgggc
gatgtctcggccccgatgctggccgatctcggctgccagttcgtcatcgtcggccattcg
gaacgccgggccgatcacggcgaaaccgatgccctggtcaaggccaaggccgaggccgcc
ctggccgccggtctgatcgccgtgatctgcgtcggcgagaccgaggcccagcgcgacgcc
ggggaaaccctggccgtggtctcgggccaattggccggatcgttgcccacccacgcggat
tcgggcaaggtggtcatcgcctatgaacccgtctgggccatcggtaccggtcgcgtgccg
acgaccgaggatgtcgccaaggtccatggcgcgctgcgcaaggatctggtcggcgccctg
ggggcggacggcaatggcgtgcgcctgctttacggcggatcggtcaagcccgacaacgcc
gccgagctgatggccttggaaaacgtcgatggcgccctggtcggcggcgccagcctcaag
gccgaggatttctgggcgatcgcccagtcctgcgcttaa

DBGET integrated database retrieval system