KEGG   Rhodospirillum rubrum F11: F11_09750Help
Entry
F11_09750         CDS       T02006                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rrf01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rrf00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2198767..2199558
Genome map
AA seq 263 aa AA seqDB search
MSDILREICDTTRAEVARRKAALPLADVTARAEDANAPRGFANALTRTADSGRPALIAEI
KKASPSAGLIRPDFNPAVLARAYHAAGATCLSVLTDGPYFQGHADFLIAARAAVPLPVLR
KDFMVDPWQVVEARAMGADCILVILAALDDGAAAEIEACAHDWGMDVLAEVHNEEECARA
LTCLTTPLLGVNNRNLKTLVTDLAVTERLAKMVPADRVLVAESGLRTRKDLDRMTAVGAR
RFLIGEHFMRQPDVGDAVRALIG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacattctgcgcgagatctgcgacaccacccgcgccgaggtggcgcggcgcaag
gccgccctgcccttagccgatgtgacggcgcgggcggaagacgccaacgcgccgcgcggc
ttcgccaacgccctgacccgcaccgccgacagcggtcggccggcgttgatcgccgaaatc
aaaaaggcctcgccctcggccgggttgatccgccccgatttcaaccccgccgtcctggca
cgcgcctatcacgccgccggggcgacctgcctgtcggtgctgaccgatggaccctatttc
caagggcacgccgatttcctgatcgccgcccgcgccgccgttcccctgccggtgctgcgc
aaggatttcatggtcgatccctggcaggtggtcgaggcccgggcgatgggggccgattgc
atcctggtcatcctggccgcccttgacgacggcgccgccgccgagatcgaagcctgcgcc
catgactggggcatggacgtgctggccgaggtccataacgaagaggaatgcgcccgcgcc
ctgacctgcctgaccacgccgctgctcggcgtcaacaaccgtaatctgaaaaccctggtc
accgatctggcggtgaccgagcgtctggccaagatggtgcccgccgaccgggtgctggtc
gccgaaagcggtctgcgcacccgcaaggacctcgaccgcatgaccgccgtcggcgcccgc
cgcttcctgatcggcgaacatttcatgcgccaacccgatgtcggcgacgccgtgcgcgcc
ctgatcggctga

DBGET integrated database retrieval system