KEGG   Rhodospirillum rubrum F11: F11_10170Help
Entry
F11_10170         CDS       T02006                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    F11_10170
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    F11_10170
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    F11_10170
Enzymes [BR:rrf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     F11_10170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2290185..2291543)
Genome map
AA seq 452 aa AA seqDB search
MTESTKYLLSEDRLPKAWYNLAADLPVPLPPPLNPGTLKPLVADDLAPIFPRAVIEQEMS
AERWIDIPEPVREVYRLWRPSPLIRARRLERALDTPAHIYFKYEGVSPAGSHKPNTSVPQ
AFYNQQEGVKKLATETGAGQWGCSLAFAGSLFGLEVQVFMVKVSFNQKPYRRALMETYGA
TCIPSPSPLTEAGRAILARDPESNGSLGIAISEAVEVAIAHDDTKYALGSVLNHVCLHQT
VIGEEALLQMEMAGDEPDVVIACTGGGSNFAGLAFPYIREKIKGRSIRIVGVEPHSCPTL
TKGRYAYDFGDTAKLTPLMKMHTLGATFMPPGSHSGGLRYHGMSPMVSHVKELGLMEARS
YHQTECFAAALQFARNEGIVPAPESSHAVKAAIDEALLAKAEGKARTILFNLSGHGHFDM
QAYTDYLAGKLKDRVFDDSLLDEALADLPVID
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagagtaccaaatacctgctgtccgaagatcggttgcccaaggcctggtacaat
ctggccgccgatctgcccgtgcccctgccgccgccgctcaaccccggaacgctgaagcca
ttggtcgccgatgatctggcgccgatcttcccgcgcgcggtgatcgagcaggagatgagc
gccgagcgctggatcgatatccccgaaccggtgcgcgaggtgtatcgcctgtggcggccg
tcgccgctgatccgcgcccggcggctcgagcgcgcccttgatacccccgcccatatctac
ttcaaatacgaaggcgtgagcccggcgggcagccataagcccaatacctcggtcccccag
gcgttctataaccagcaagagggcgtcaagaagctggcgaccgaaaccggcgccggccaa
tggggctgttcgctggccttcgccggatcgctgttcggcctggaagtccaagtgttcatg
gtcaaggtgtcgttcaatcagaagccctatcgccgggcgctgatggaaacctatggcgcc
acctgcattcccagcccctcgccgctgaccgaggccggccgcgccattctggcccgcgac
ccggagtccaacggctcgctcggcatcgccatttccgaggcggtcgaggtcgccatcgcc
catgacgacaccaaatacgccctgggcagcgtcctcaatcacgtctgcctgcatcagacg
gtgatcggcgaagaagcgctgttacagatggagatggccggcgacgagcccgatgtggtg
atcgcctgcaccggcggcggctcgaacttcgccggactggccttcccctatatccgcgag
aagatcaaggggcggtcgatccgcatcgtcggcgtcgaaccccattcctgcccgaccctg
accaagggccgctatgcctatgatttcggcgatacggccaagctgacgcccttgatgaag
atgcataccctgggcgccaccttcatgccgcccggctcgcattccggcggcctgcgctac
cacggcatgtcgccgatggtcagccacgtcaaggaactgggcctgatggaggcgcggtcc
tatcaccagaccgaatgcttcgccgccgccctgcaattcgcccgcaacgaaggcatcgtt
cccgcacccgagtcttcgcatgcggttaaggccgccatcgacgaagccttgctggccaag
gccgaaggcaaggcgcggacgatcctgttcaatctgtcgggccacggccatttcgacatg
caggcctatacggattatttggccggaaagctcaaggaccgggtgttcgacgacagtctg
cttgacgaagccttggccgatctgccggttatcgactga

DBGET integrated database retrieval system