KEGG   Rhodospirillum rubrum F11: F11_10885Help
Entry
F11_10885         CDS       T02006                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    F11_10885
   00052 Galactose metabolism
    F11_10885
   00500 Starch and sucrose metabolism
    F11_10885
   00520 Amino sugar and nucleotide sugar metabolism
    F11_10885
Enzymes [BR:rrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     F11_10885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2457523..2458389)
Genome map
AA seq 288 aa AA seqDB search
MRKAVFPVAGMGTRFLPATKTMAKEMLPVVDKPLIQYAVEEAAAAGIDHFIFITGRGKSV
LMDHFDHMPELEALLKERGKTDVLENLLGSMPSPGKVFSTRQQQPLGLGHAVWCARAFIG
DEPFAVLLPDDLVLADTPCIKQLIDAHAQTGGNVVAVEDVPRERTNKYGILDVVEDNGTL
ARAKGLVEKPDSDKAPSTLAIIGRYVLDPGIFDLLENQNRGAGGEIQLTDAMNAQIKDVP
FHGLRYEGARYDCGDKVGFLQANIAFALERPDMRDAVKAVLADFAKTI
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcaaggccgtatttccggttgccggaatgggaacgcgtttcctgccggcgaccaag
accatggcgaaggaaatgctgcccgtcgtcgataagccgctgatccaatacgcggtcgaa
gaagccgccgccgccggtatcgatcacttcatcttcatcaccggtcgcggcaaatcggtg
ctgatggaccatttcgaccatatgcccgagcttgaggccctgctcaaggaacgcggcaag
accgatgttctggaaaacctgctgggctcgatgccctcgccgggcaaggtgttctccacc
cgccagcagcagccccttggcctgggtcacgccgtgtggtgcgcccgcgccttcatcggc
gatgagcccttcgccgttctgctgcccgatgatctggtgctggccgatacgccctgcatc
aagcagctgatcgacgcccacgcgcagaccggcggcaatgtcgtcgccgtcgaggacgtg
ccgcgcgagcgcaccaacaaatacggcatcctcgacgtcgtcgaggacaacggcaccctg
gcccgggccaagggtttggtcgaaaagcccgattccgacaaggcgccctcgaccctggcg
attatcggccgctatgtgctcgatccgggcattttcgacctgctcgaaaaccagaaccgc
ggtgccggtggcgagatccagttgaccgacgccatgaacgcccagatcaaggacgttccc
ttccatggcctgcgctatgagggcgcgcgctatgactgcggcgacaaggtgggcttcctg
caggccaatatcgccttcgccctggagcggcccgatatgcgcgacgccgtgaaggccgtt
ctcgccgatttcgccaagaccatctga

DBGET integrated database retrieval system