KEGG   Rhodospirillum rubrum F11: F11_11810Help
Entry
F11_11810         CDS       T02006                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    F11_11810
Enzymes [BR:rrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     F11_11810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2658200..2659129)
Genome map
AA seq 309 aa AA seqDB search
MSGRIAVVGSNMVDLITYVTRMPDKGETIEAPNFALGCGGKGANQAIAAARLGADVLMVT
RVGDDIFADNTIANFKANGIDTRFVRKVPGTPSGVAPIFVEQNGENSILIVKGANAHLSP
ADVEEAGEALKGCALILMQLEVPLETIYATVAFGAAHGIPTLLNPAPAVPELDVERLRTL
SFLTPNETELAILSGMPVASETEVEAAARSLIAKGVRTVIVTMGARGALLVEEKGATRIA
PVRVTPKDTTGAGDAFIGSFAHYYTQNGDIAAALRKAVRYAADSITRNGTQSSYATLAEF
EAFCATIDA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcaggatcgccgttgtcggcagcaatatggttgacctgattacctatgtcacc
cgcatgcccgacaagggcgagaccatcgaggcgccgaacttcgccctgggctgcggcggc
aagggggccaatcaggcgatcgccgccgcccgcttgggcgccgatgtgctgatggtcacc
cgggttggcgatgacatcttcgccgacaataccatcgccaatttcaaggccaatggcatc
gatacccgctttgtgcgcaaggttccgggcacgccgagcggcgtcgcgccgatcttcgtc
gaacaaaacggcgaaaactcgatcctgatcgtcaagggcgccaatgcccatctatcgccg
gccgatgtcgaggaggccggcgaggcgctgaaaggctgcgccctgatcctgatgcagctc
gaagtgcccctggaaaccatctatgccacggtggcctttggcgcggcgcacggcattccg
accttgctcaatcccgccccggcggtgcccgagctcgatgtcgagcgcctgcgcacgctc
tccttcctgacccccaatgaaaccgaactggcgatcttgtcggggatgccggtggcgagc
gaaaccgaggtcgaggccgccgcccgcagcctgatcgccaagggcgtgcgcacggtgatc
gtcaccatgggcgcgcgcggcgccttgctggtcgaggaaaagggcgccacccgcatcgcg
ccggtccgcgtgacccccaaggacaccaccggggcgggcgacgccttcatcggcagcttc
gcccattactatacgcaaaacggcgatatcgccgccgccctgcgcaaggcggtgcgctat
gccgccgattcgatcacccgcaacggcacccaaagctcctatgccaccctggccgagttc
gaggccttctgcgcgacgatcgacgcctag

DBGET integrated database retrieval system