KEGG   Rhodospirillum rubrum F11: F11_11945Help
Entry
F11_11945         CDS       T02006                                 

Definition
two component CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:rrf02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:rrf02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2693636..2694748
Genome map
AA seq 370 aa AA seqDB search
MTKVLIVDDSALMRRHLKEILEVHGGFEVMVARNGIEALAGLESFDPDVITLDINMPEMD
GLTCLSRIMATKPKPVVMVSSLTETGAEVTLEALALGAVDFIHKPDGTISLNVSRIEREI
LDKVTAAAKARIRRSLGLSSRLRTASDRGAAKRTRPADSSPLPTLSLTEIGVVLIGVSTG
GPGTLEEVLPGLSAGFPWPVVVAQHMPGSFTPVFARRLNDLCPLTVIEASAQMPLEPGVI
YIAKGDADVVIGHRATRFVVNPMPAGPHYLWHPSVTRLVESALRALPPERIIGVLLTGMG
DDGAEAMAEVKRRGGRTIAQDEASSVIFGMPGELVKRGGANLVLPASRIAGQLNAWMSRT
KETVYGTGQS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagttctgattgtcgatgactcggcgctcatgcggcgtcatctgaaggaaatc
ctcgaagtccacggcggcttcgaggtgatggtggcgcgcaatggcatcgaggcgctggcc
ggcctggaaagcttcgaccccgatgtcatcacccttgatatcaacatgcccgagatggat
ggcctgacctgcctgtcgcggatcatggcgaccaagccaaaaccggtggtgatggtgtcg
tctttgaccgaaaccggcgccgaggtcaccctcgaggccctggccttgggggcggtcgat
ttcatccacaaacccgatggcaccatttccctcaatgtctcgcgcatcgagcgcgaaatc
ctcgacaaggtcaccgccgccgccaaggcccgtattcgccgctcgctcggattgtcgagc
cgcttgcgcacggccagcgaccgcggcgccgccaagcggacccgtcccgccgactcctcc
cccctccccaccctgtccctcaccgagatcggcgtggtgctgatcggggtttcaaccggt
ggaccgggaaccctggaagaggttctgcccggtctgtccgccggctttccctggccggtg
gtggtggcccagcacatgccaggcagcttcaccccggtgttcgcccgccgcctcaatgac
ctatgtccgttgacggtgatcgaggcctcggcgcagatgccgctggaacccggggtgatc
tacatcgccaagggcgacgccgacgtggtgatcggccatcgcgccacccgttttgtcgtc
aatccgatgcccgccggcccccattatctgtggcatcccagcgtcacccgccttgtcgag
agcgcgctgcgcgccctgccgcccgagcgcatcatcggcgtgttgttgaccggcatggga
gatgacggcgccgaggcgatggccgaggtgaagcggcgcggcgggcgcaccatcgcccag
gacgaagccagctccgtcatctttggcatgcccggagagctggtcaaacgcggcggcgcc
aatctggtgctgccggccagccgcatcgccggtcagctcaatgcgtggatgtcacgaacc
aaggagacggtctatgggactggtcagagctga

DBGET integrated database retrieval system