KEGG   Rhodospirillum rubrum F11: F11_12770Help
Entry
F11_12770         CDS       T02006                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    F11_12770
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F11_12770
   00052 Galactose metabolism
    F11_12770
   00500 Starch and sucrose metabolism
    F11_12770
   00520 Amino sugar and nucleotide sugar metabolism
    F11_12770
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    F11_12770
   00524 Butirosin and neomycin biosynthesis
    F11_12770
Enzymes [BR:rrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     F11_12770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2890015..2890989
Genome map
AA seq 324 aa AA seqDB search
MAEPFIPGLIADIGGTNARFALTTPEGGWRDERVYRCAAFPGPAEAAAHYLAEVLTAFEP
RPDRGAICVACPVNGDHLALTNHGAWSFSISAVADRLGLAPFHAVNDFIANALAIPRLGP
SGLIEIGGGAGLTGAPIAAIGPGTGLGVAILIPGRGGNRTSPLATEGGHVTLPAVTDREA
VIISALRAIHGHASAERAISGPGLVWLSEAIRAADGLEPVAETPPSVMEKGLARSCPVCA
EAVDTFYALLGTVAGNLVLSTGAQGGVYLMGGILPRHPEALRTSAFLARFHEKGRFRDYL
DVVPIRLVTHPYPAFIGLAGLVSD
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggctgagccgttcattcccggattgatcgccgatatcggcggcaccaacgcccgcttc
gccctgaccacccccgagggcggctggcgcgacgaacgggtttaccgctgcgccgccttt
cccggcccggccgaggcggcggcccattatctggccgaggtgctgaccgcctttgaaccg
cgccccgatcgcggggcgatctgcgtcgcctgtccggtcaacggcgatcatctggctttg
accaaccatggggcgtggtcgttctcgatcagcgcggtcgccgaccgcttgggtttggcg
cctttccatgcggtcaatgacttcatcgccaacgccctggccatcccccgccttggcccc
tccgggctgatcgagatcggcggcggcgccggacttaccggggcgccgatcgccgcaatc
ggcccgggcaccggtctgggggtggcgatcctcatccccggtcgcggcggcaaccgcacc
agccccctggccaccgagggcggccatgtcaccctgcccgccgtgaccgaccgcgaggcg
gtgatcatcagcgccctgcgcgccattcacggccacgcctcggccgagcgggcgatttcc
ggccccggtctggtttggctgagcgaggcgatccgcgccgccgatggcttggagccggtt
gccgaaaccccgccctcggtgatggaaaagggcttggcgcgcagctgcccggtttgcgcc
gaagccgtcgacaccttttacgcgctgctgggcacggtggcgggcaatctggtgctgagc
accggcgcccagggcggcgtttacctgatgggaggtatcctgccccgacacccagaggcc
ttgcgaacctcggccttcctggcgcgcttccacgaaaagggccgcttccgcgattacctt
gatgtcgtccccattcgcttggtcacccacccctatccggccttcatcggtctggccggg
ctggtcagcgattag

DBGET integrated database retrieval system