KEGG   Rhodospirillum rubrum F11: F11_15375Help
Entry
F11_15375         CDS       T02006                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    F11_15375
Enzymes [BR:rrf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     F11_15375
    3.5.1.-  
     F11_15375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3459252..3459857
Genome map
AA seq 201 aa AA seqDB search
MTDALVLIDIQNDFCPGGALAVPEGDRVVAVANRLAPMFGTVILSQDWHPADHRSFVTAH
PGKAAFESVTMDYGPQVLWPPHCVAGTRGAAFVDGLDLGPAHVIVRKGTNRDTDSYSAFQ
ENDKRTSTGLAGLLRERGIERIFLAGLATDFCVCYSALDARALGFEVCLVEDGCRAIDLD
GSLDLARAKMAAAGVKIVTSP
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgccctggtgctgatcgatatccagaacgacttctgtcccggtggtgccctg
gccgttcccgaaggcgatcgggtggtggcggtggccaaccggctggcgccgatgttcggc
acggtgatcctcagccaggattggcacccggccgatcaccgctcgtttgtcaccgcccat
cccggcaaggccgccttcgagtccgtgaccatggactacggcccccaggtcttgtggccg
ccccattgcgtggccggaacccggggcgcggcctttgtcgacggcctggatctcggcccg
gcccatgttatcgtgcgcaagggcaccaaccgcgacaccgacagctattcggccttccag
gaaaacgacaagcgcaccagcaccggtctggccgggctgttgcgcgaacgcggcatcgag
cggatcttcctggccggattggcgacggacttctgcgtctgttacagcgccctggacgcc
cgcgccctgggcttcgaggtctgtctggtcgaagacggctgccgggccatcgatcttgac
ggatcgctggaccttgcccgggcgaagatggcggcggccggggtgaagatcgtcaccagc
ccctga

DBGET integrated database retrieval system