KEGG   Rhodospirillum rubrum F11: F11_16340Help
Entry
F11_16340         CDS       T02006                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    F11_16340
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    F11_16340
Enzymes [BR:rrf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     F11_16340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3679306..3680265
Genome map
AA seq 319 aa AA seqDB search
MSAILFPEYTHRHLLGIEGLVPVEVTALLDRAEIYANRNRSANKVSDEMRGRTVINLFFE
NSTRTRTSFELAARRLGADVINMQVGSSSVAKGETLIDTAVTLNAMHPDVLVVRHAESGA
AALLAQKVNCAVINAGDGAHEHPTQALLDALTIRRRKGRLGGLDVAICGDVLHSRVARSN
IHLLTLMGARVRVVGPRPLIPSGIGELGVDIFHDMREGLRGVDIVMMLRIQMERMQGNFI
PSVREYFRYFGLDREKLALAKPDALIMHPGPMNRGVEIDSDVADDFERSVIREQVEMGVA
VRMAVLEVLSGNLASMETA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgatcttgttccccgaatacacccaccgccatctgctcggaatcgaaggcctg
gtgcccgtcgaggtcaccgccctgctcgaccgcgccgagatctacgccaaccgcaatcgc
tcggccaacaaggtcagcgacgagatgcgggggcgcacggtcatcaacctgttcttcgaa
aattcgacgcgcacccgcaccagcttcgaactggcggcgcggcgcctgggcgccgatgtc
atcaacatgcaggtgggctcgagcagtgtcgccaagggggaaaccctgatcgacaccgcc
gtcaccctcaacgccatgcatcccgatgtgctggtggtccgccatgccgagtcgggcgcg
gcggccctgctcgcccaaaaggtcaattgcgcggtcatcaacgccggcgacggcgcccac
gagcatccgacccaggccctgctcgacgccctgaccatccgccggcgcaagggccggctg
ggcgggctggacgtggcgatctgcggcgatgttctgcattcgcgggtggcgcggtccaac
atccacttgctgaccctgatgggggcgcgggtgcgcgttgtcggaccacggccgctgatc
ccctcgggcatcggcgaattgggcgtcgatatcttccatgacatgcgcgaaggcctgcgc
ggcgttgatatcgtgatgatgctgcgcatccagatggagcgcatgcagggcaacttcatt
cccagcgtgcgcgaatacttccgctatttcggcctcgaccgcgagaaactggccctggcc
aagcccgatgccctgatcatgcatccgggaccgatgaatcgcggggtcgagatcgattcc
gacgtggccgatgatttcgaacgcagcgtgatccgggagcaggtggaaatgggcgtcgcg
gtgcgcatggcggttctcgaggtgctgtcgggcaacctcgcctcgatggagaccgcataa

DBGET integrated database retrieval system