KEGG   Rhodospirillum rubrum F11: F11_16560Help
Entry
F11_16560         CDS       T02006                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    F11_16560
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    F11_16560
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    F11_16560
Enzymes [BR:rrf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     F11_16560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3727955..3729367
Genome map
AA seq 470 aa AA seqDB search
MRYVSTRGQAPVLSFDDVLLAGLASDGGLYVPQTWPSFSEDDIRDMRALTYQELAVRVMG
PFMGAAVTDDELTEVVEQAYAGFSHPAVAPLVQIGAHDWVMELFHGPTLAFKDYALQVVG
GLFDLILTRRGSRITVVGATSGDTGSAAIEACRDREAVDVIILLPKGRVSEVQRRQMTTV
TSSNVHAIEVEGTFDDCQALVKALFNDPAFRSEVNLAAVNSINWARIMAQTVYYFWAALQ
LGAPDRSLGFSVPTGNFGNVLAGYCAKRMGLPIDRLVVGSNSNDILTRFLETGTMQSRGV
VQTHSPSMDIQVSSNFERLLFEVVDRDSAEVERLMAQFALTGGYTLDSALHQELLGLFRG
FRVDNDATLRAIAELYAATGMILDPHSVIGVIAGREAGHRDTGTPMVALATAHPAKFADV
VEQATGQRPALPGALSDLLTRPERRAEVANDPEAVKALVRSLSRVPGASA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgagatatgtaagcacacggggtcaggccccggtcctgtcctttgatgatgtcctgctg
gccgggctggccagtgacggggggctttatgtcccgcagacctggcccagtttctccgaa
gacgatatccgggacatgcgcgcgctgacctatcaggagttggcggtgcgggtgatgggc
cccttcatgggcgccgccgtcaccgatgacgaattgaccgaggtggtcgaacaggcctat
gccggcttttcccatcccgccgtcgccccgctggtgcagatcggcgcccacgactgggtg
atggagctgttccacggtccgaccctggccttcaaggattacgccctgcaggtcgtcggc
ggcctgttcgacctgatcctcacccggcgcggcagccgcatcaccgttgtcggcgcgacc
agtggcgatacgggcagcgccgccatcgaggcctgccgcgaccgcgaggcggtcgatgtc
atcatcttgctgcccaagggccgggtctcggaggtccagcgccgccagatgacgacggtg
accagctccaacgtccatgccatcgaggtcgaaggcaccttcgatgattgtcaggccctg
gtgaaggcgctgttcaacgaccccgccttccgctccgaggtcaatctggcggcggtcaat
tccatcaactgggcgcggatcatggcccagacggtttattacttctgggccgccctgcag
cttggcgcgcccgaccgctcgcttggcttcagcgtgcccaccggcaatttcggcaatgtg
ctggcgggctattgcgccaagcgcatgggcctgccgatcgaccgtctggtggtcggctcc
aacagcaacgacatcctgacccgcttcctggaaaccggcaccatgcagtcgcgcggcgtg
gttcagacccacagcccgtcgatggacatccaggtgtcgagcaactttgagcgcctgctg
ttcgaggtggtcgaccgcgacagcgccgaggtcgagcggctgatggcccaattcgccctg
accggcggctatacccttgatagcgcccttcatcaggagcttcttgggctgttccgcggc
ttccgggttgataacgacgccaccttgcgcgccatcgccgaactttacgccgccaccggc
atgatccttgatccccatagcgtcatcggcgtcatcgccgggcgcgaagccggccaccgc
gacaccggcactccgatggtcgccctggccaccgcccatccggccaaattcgccgatgtg
gttgaacaagccaccggccagcgcccggccctgcccggcgcgctttccgaccttttgacc
cgacccgaacgccgggccgaggtcgccaacgaccccgaggcggtgaaagcgctggtgcgc
agcctctcgcgggtccctggagcatccgcatga

DBGET integrated database retrieval system