KEGG   Rhodospirillum rubrum F11: F11_16915Help
Entry
F11_16915         CDS       T02006                                 

Definition
glucan 1,4-alpha-glucosidase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    F11_16915
Enzymes [BR:rrf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     F11_16915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3800703..3802073
Genome map
AA seq 456 aa AA seqDB search
MSEAPSATGLEDWLTTQIPRSAEWMLSAVSRVDLVKERPLFGQRIVPLPGSILASPVDAA
WDPEPDYFFHWFRDAAVILDAIRVLALDGILSAARAKALLHDSLTFAQTVARLQGAALAD
GAYRTATRPEGVQYLRDPASIAGICGLRVAAETRVNADGTFDITTWARPQTDGPALRALT
HLRWDAQGTVDEADRPLLQALIAADLAVVEALWAEPSFDPWEEECGTHYYTRLLQAEALE
RGADWLAGGATDASPTEAKTQADRLRQTARTILDQLESHWTGDILVSRQGIEGGGDPGKL
LDIAVILGVVHAAREGDRHGLLDPRIEATFAALEALFRADYPINHALPPGRGPAFGRYRT
DAYFSGGAFYFSTFGAAEYHYHRARLRNDPASLAAGDAILATTRAYAPADGDMAEQFDKT
TGAQSSARTLAWSHAGLITAASARRRAQDHLGGILQ
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggcgccttcggccaccggccttgaagactggctgaccacgcaaatcccgcgc
tcagccgaatggatgctgagcgcggtgtcgcgcgtcgatctggtcaaggagcggccgctg
tttggtcaaaggatcgtgccgctgcccggctcgatcctggcctcgccggtcgatgccgcc
tgggacccggagcccgattatttcttccactggttccgcgacgcggcggtgatcctcgac
gccatccgcgtgctcgccctcgacgggatcctgagcgcggcacgcgccaaggccctgctc
cacgacagcctgaccttcgcccaaaccgtcgccaggctgcaaggcgcggcgctggccgat
ggcgcctaccggacggcgacccgccccgagggggtgcaatacctgcgcgatcccgccagc
atcgccgggatctgcggcttgcgcgtcgccgcggaaacccgggtcaatgccgatggcacc
ttcgatatcaccacctgggcccggccgcagaccgatggcccggcgctgcgcgcgctcacc
catctgcgctgggatgcccaagggacggtcgacgaggccgaccgtcccttgctccaggcc
ttgatcgccgccgatctcgccgtggtcgaggcgctgtgggccgagccgtcgttcgaccct
tgggaggaggaatgcggcacccattactatacccgcctgcttcaggccgaagccctggag
cgtggcgccgattggctcgctggcggggcgaccgacgcctcgccaaccgaagccaaaacc
caggccgaccggctgcgccagaccgcccgcaccatcctcgatcaacttgaaagccattgg
accggcgacattctggtctcgcgccaggggatcgagggcgggggcgatccgggaaagctc
ctggatatcgcggtgatcttgggggttgtccacgcggcgcgcgagggcgatcgccatggc
ctgctcgatccgcggatcgaagcgaccttcgccgccctcgaagcgctgtttcgcgccgat
tatccgatcaaccacgccctgccccccgggcgcgggccggctttcgggcgctatcgcacc
gatgcctatttcagcggcggggccttctatttctcgaccttcggcgcggccgaataccat
taccaccgcgcccgactgcgcaacgacccggccagtctggccgccggcgacgccattctg
gccacaacccgcgcctatgcgcccgccgatggcgacatggccgaacaattcgacaagacc
accggcgcccaatcctcggcccgcaccctggcctggagccacgccgggctgatcaccgcc
gccagcgcccgacggcgggcacaagaccatctgggcggcattctccaatag

DBGET integrated database retrieval system