KEGG   Rhodospirillum rubrum F11: F11_17460Help
Entry
F11_17460         CDS       T02006                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:rrf01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:rrf01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:rrf00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:rrf00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rrf00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:rrf00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:rrf00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3924018..3925232
Genome map
AA seq 404 aa AA seqDB search
MFKGKVVVAQGGGPTAVINQSMVGAVLESRKFRNVELVYGAVHGVRGIVDEHFLDLTQET
THNLEMVAETPSSALGSTREKPDLKYCQEIFKVLKAHEIGYFFYIGGNDSSDTVRIVSEE
AAKADYGLRCIHIPKTIDNDLVVNDHTPGFPSAARFVAQAFSGVNLDNQALPGVYIGVVM
GRHAGFLTAASALGKKFQDDGPHLIYLPERTFDVDTFVSDVKEVYDRTGRCIVAVSEGIH
DASGEPIITKLAEEVERDAHGNVQLSGTGALADLLVSVVKKKSGIKRVRGDTLGYLQRSF
VGCVSDVDQREAREVGEKAVQYAMWGQTNGSVTIHRTGFYSVDYQLTPLLDVAGKTRTMP
DSFIAANGHDVTTDFLMYLRPLLGRGMPDAYRLRDNRVAKVLNR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagggcaaggtcgttgtcgcccaaggcggcggccccacggccgtcatcaaccag
tcgatggttggcgcggttttggaatcgcgtaagttccgcaatgttgagctggtttatggc
gccgttcatggtgtgcgcggcatcgtcgacgagcatttcctcgacctgacccaggaaacc
acccataacctggaaatggtcgccgaaacgccgtcttcggctttgggatcgacccgcgag
aagcccgatctcaaatactgccaggagatcttcaaggtcctcaaggcccatgagatcggc
tatttcttctatatcggcggcaatgattcctccgataccgtgcgcatcgtctcggaagag
gcggccaaggccgattacggtctgcgctgcattcatatccccaagacgatcgacaacgat
ctggtggtcaacgaccatacgccgggcttcccctcggcggcgcgcttcgtcgcccaggcc
ttcagcggcgtcaatctcgacaatcaggccctgcccggcgtttatatcggcgtggtgatg
ggccgtcatgccggcttcctgacggcggccagcgcacttggcaagaagttccaggacgac
ggcccgcatctgatctacctgcccgaacgcaccttcgatgtcgacaccttcgtctctgac
gtcaaggaggtctatgaccggactgggcgctgcatcgtggcggtcagcgagggcatccac
gacgcctcgggcgagccgatcatcaccaagctggccgaggaggtcgaacgcgacgcccat
ggcaacgtccagctttcgggcaccggcgccctggccgacctgctggtcagcgtcgtcaag
aagaagagcggcatcaagcgggtgcgcggcgataccttgggctatctgcagcgcagcttc
gtcggctgcgtctccgacgtcgaccagcgcgaagcccgcgaagtcggcgaaaaggccgtg
caatacgccatgtggggtcagaccaacgggtcggtcaccatccatcgcaccggcttctat
tcggtcgattatcagctgacgccgctgcttgatgtcgccggcaagacgcggaccatgccc
gattcgttcatcgccgcgaacggccatgacgtgaccaccgatttcctgatgtacctgcgg
ccgttgctgggccgtggcatgcccgacgcctatcgcctgcgcgacaatcgggttgccaag
gttctcaaccgctaa

DBGET integrated database retrieval system