KEGG   Rhodospirillum rubrum F11: F11_17460Help
Entry
F11_17460         CDS       T02006                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    F11_17460
   01230 Biosynthesis of amino acids
    F11_17460
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    F11_17460
   00030 Pentose phosphate pathway
    F11_17460
   00051 Fructose and mannose metabolism
    F11_17460
   00052 Galactose metabolism
    F11_17460
  Energy metabolism
   00680 Methane metabolism
    F11_17460
Enzymes [BR:rrf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     F11_17460
Protein phosphatases and associated proteins [BR:rrf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     F11_17460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3924018..3925232
Genome map
AA seq 404 aa AA seqDB search
MFKGKVVVAQGGGPTAVINQSMVGAVLESRKFRNVELVYGAVHGVRGIVDEHFLDLTQET
THNLEMVAETPSSALGSTREKPDLKYCQEIFKVLKAHEIGYFFYIGGNDSSDTVRIVSEE
AAKADYGLRCIHIPKTIDNDLVVNDHTPGFPSAARFVAQAFSGVNLDNQALPGVYIGVVM
GRHAGFLTAASALGKKFQDDGPHLIYLPERTFDVDTFVSDVKEVYDRTGRCIVAVSEGIH
DASGEPIITKLAEEVERDAHGNVQLSGTGALADLLVSVVKKKSGIKRVRGDTLGYLQRSF
VGCVSDVDQREAREVGEKAVQYAMWGQTNGSVTIHRTGFYSVDYQLTPLLDVAGKTRTMP
DSFIAANGHDVTTDFLMYLRPLLGRGMPDAYRLRDNRVAKVLNR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttcaagggcaaggtcgttgtcgcccaaggcggcggccccacggccgtcatcaaccag
tcgatggttggcgcggttttggaatcgcgtaagttccgcaatgttgagctggtttatggc
gccgttcatggtgtgcgcggcatcgtcgacgagcatttcctcgacctgacccaggaaacc
acccataacctggaaatggtcgccgaaacgccgtcttcggctttgggatcgacccgcgag
aagcccgatctcaaatactgccaggagatcttcaaggtcctcaaggcccatgagatcggc
tatttcttctatatcggcggcaatgattcctccgataccgtgcgcatcgtctcggaagag
gcggccaaggccgattacggtctgcgctgcattcatatccccaagacgatcgacaacgat
ctggtggtcaacgaccatacgccgggcttcccctcggcggcgcgcttcgtcgcccaggcc
ttcagcggcgtcaatctcgacaatcaggccctgcccggcgtttatatcggcgtggtgatg
ggccgtcatgccggcttcctgacggcggccagcgcacttggcaagaagttccaggacgac
ggcccgcatctgatctacctgcccgaacgcaccttcgatgtcgacaccttcgtctctgac
gtcaaggaggtctatgaccggactgggcgctgcatcgtggcggtcagcgagggcatccac
gacgcctcgggcgagccgatcatcaccaagctggccgaggaggtcgaacgcgacgcccat
ggcaacgtccagctttcgggcaccggcgccctggccgacctgctggtcagcgtcgtcaag
aagaagagcggcatcaagcgggtgcgcggcgataccttgggctatctgcagcgcagcttc
gtcggctgcgtctccgacgtcgaccagcgcgaagcccgcgaagtcggcgaaaaggccgtg
caatacgccatgtggggtcagaccaacgggtcggtcaccatccatcgcaccggcttctat
tcggtcgattatcagctgacgccgctgcttgatgtcgccggcaagacgcggaccatgccc
gattcgttcatcgccgcgaacggccatgacgtgaccaccgatttcctgatgtacctgcgg
ccgttgctgggccgtggcatgcccgacgcctatcgcctgcgcgacaatcgggttgccaag
gttctcaaccgctaa

DBGET integrated database retrieval system