KEGG   Rhodospirillum rubrum F11: F11_17560Help
Entry
F11_17560         CDS       T02006                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    F11_17560
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    F11_17560
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    F11_17560
Enzymes [BR:rrf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     F11_17560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
3944688..3945914
Genome map
AA seq 408 aa AA seqDB search
MTTMPNTYRSGPDDRGHFGLHGGRYVAETLMPLILDLEKAWEATRDDPAFKAELGGYLAT
YVGRPSPLYFARRLTEALGGAKIYFKREDLNHTGAHKINNCMGQILLARRMGKTRIIAET
GAGQHGVATATVCALFGMPCVIYMGATDIERQAPNVFRMKLLGAEVRPVTSGAGTLKDAM
NDAMRDWVANVADTYYLIGTAAGPHPYPAMVRDLQKVIGEEARAQVLEAEGRLPDTLIAC
IGGGSNAIGLFHPFLDDPDVRIIGVEAAGEGLDKRHAASMAGGRLGVLHGNRTYLLQDGA
GQITEAHSISAGLDYPGVGPEHAWLKDSGRVEYVPITDDEAVHAFQETTKLEGIIPALES
SHAIAHAMKIAPTLPADHLMVVSLSGRGDKDVGTIAKVLGSDFKGMMP
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatgccaaacacctaccgctccggccccgatgatcgcggtcatttcggactg
cacggcgggcgctatgtcgccgaaaccctgatgccgctgatcctcgatctggaaaaggct
tgggaagcgacccgcgatgatccggcgttcaaggccgagctgggcggctatctcgccacc
tatgtcggccggccgagcccgctgtacttcgcccgccgtctgaccgaggccctgggcggg
gcaaagatctatttcaagcgcgaagacctcaaccatacgggcgcccataagatcaacaat
tgcatggggcagatcctgctcgccaggcgcatgggcaagacgcggatcatcgccgaaacc
ggcgccggccagcatggggtggccaccgccaccgtctgcgccctgtttggcatgccctgc
gtgatttacatgggcgccaccgatatcgagcgtcaggcgcccaatgtgttccgcatgaag
ctgcttggcgccgaggtccgcccggtgaccagcggcgcgggcaccctcaaggacgcgatg
aacgacgccatgcgcgactgggtcgccaatgtcgccgacacctattacctgatcggcacg
gcggccggcccccatccctatccggcgatggtccgcgacctgcagaaggtcatcggcgag
gaagcccgcgcccaggtgctcgaggccgagggtcggctgcccgacaccctgatcgcctgc
atcggcggcggctccaacgccatcggcctgttccaccccttcctggacgatcccgacgtg
cgcatcatcggtgtcgaggccgccggcgagggcttggacaagcgccatgccgcctcaatg
gccggggggcgtctgggcgtgctgcatggcaaccgcacctatctgcttcaggacggcgcc
ggccagatcaccgaggcccattcgatttccgccggcctggattatcccggcgtcggcccc
gagcacgcctggctcaaggacagcggccgggtcgagtatgtgccgatcaccgacgacgag
gcggttcacgccttccaggaaaccaccaagctcgaagggatcattccggccctggaaagc
agccacgccatcgcccatgccatgaagatcgcccccaccctgccggccgatcatctgatg
gtggtcagcctgtcggggcgcggcgacaaggacgtggggacgatcgccaaggttctgggc
agtgatttcaagggaatgatgccgtga

DBGET integrated database retrieval system