KEGG   Rhodospirillum rubrum F11: F11_17565Help
Entry
F11_17565         CDS       T02006                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rrf  Rhodospirillum rubrum F11
Pathway
rrf00260  Glycine, serine and threonine metabolism
rrf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rrf01100  Metabolic pathways
rrf01110  Biosynthesis of secondary metabolites
rrf01130  Biosynthesis of antibiotics
rrf01230  Biosynthesis of amino acids
Module
rrf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rrf00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    F11_17565
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    F11_17565
Enzymes [BR:rrf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     F11_17565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: AEO49973
Position
3945911..3946726
Genome map
AA seq 271 aa AA seqDB search
MSATTPTTDRLSRRFAALKAEGRGGLVTYVMAGDPDQETALALMRGLPGAGADIIELGMP
FSDPMADGPAIQAAALRALAAGMTLTGTLETLKAFRATDDDTPVVLMGYYNPIHYYGAEA
FARDAALAGADGLIIVDLPPEEADELLPFLRAQGLHLIMLATPTTDEARLPAILERASGF
LYYVSIAGITGTAAADAGGVAQAVARIRRKTDLPIAIGFGVSTPAQAATMARVGDAAVVG
SAIVRRLAEGGDVLGFVGELAGALRKVDAAG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccaccacgccgaccaccgatcgcctctcccgccgcttcgccgccctcaaggcc
gaaggccgggggggccttgtcacctatgtcatggccggcgatcccgaccaggaaacggcc
ctcgccctgatgcgcggcctgcccggcgccggggccgatatcatcgaattgggaatgccg
ttttccgatccgatggccgatggcccggcgatccaggccgccgccctgcgcgccctggcc
gccgggatgaccctgacggggaccttggaaaccctgaaggcgttccgcgccaccgatgat
gacaccccggtggttctgatgggctattacaatcccatccattattacggggccgaggcc
ttcgcccgcgacgccgccctggccggcgccgacggcctgatcatcgtcgacctgccgccc
gaggaggccgacgagcttctacccttcctgcgcgcccagggtctgcatctgatcatgctg
gcgacgccgaccaccgatgaggcgcggctgccggcgattctcgagcgggcgagcgggttt
ctttattatgtttcgatcgccggcatcaccggaacggccgccgccgatgccgggggcgtc
gcccaggcggtcgcccgcatccgccggaaaaccgatctgccgatcgccatcggctttggc
gtatccaccccggcccaggcggcgacgatggcgcgggtcggtgatgccgccgtggtcggt
tcggccattgtccgccggctggccgagggcggggacgtgctgggcttcgttggcgaattg
gccggcgccctgcgcaaggtcgacgcggcggggtaa

DBGET integrated database retrieval system